RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780418|ref|YP_003064831.1| 50S ribosomal protein L25/general stress protein Ctc [Candidatus Liberibacter asiaticus str. psy62] (191 letters) >gnl|CDD|180166 PRK05618, PRK05618, 50S ribosomal protein L25/general stress protein Ctc; Reviewed. Length = 197 Score = 227 bits (581), Expect = 2e-60 Identities = 78/181 (43%), Positives = 117/181 (64%) Query: 7 KLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILT 66 L A +R++ GKG+AR LR+ G++PA+IYG +P I++ K++ K L F++T+L Sbjct: 5 TLEAEVREEFGKGAARRLRRAGKVPAVIYGKGKEPVSISVDEKELIKALKKGAFLSTLLD 64 Query: 67 LDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQGGK 126 L++G + V+ KD Q PV D ++H DFL+V G V V VPV F+ E K G+K GG Sbjct: 65 LEVGGKKQKVLVKDVQRHPVKDFILHVDFLRVDAGEKVKVEVPVHFVGEAKGVGVKLGGV 124 Query: 127 LNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLPEKTSSMSQLNITIATIVA 186 LN V HE+ + C +IP+ I VD++ L+IGDSIH+ D++LPE + + +AT+VA Sbjct: 125 LNQVLHELEVECLPEDIPEFIEVDVSGLEIGDSIHVSDLKLPEGVKLLDDPDEVVATVVA 184 Query: 187 P 187 P Sbjct: 185 P 185 >gnl|CDD|162013 TIGR00731, ctc_TL5, ribosomal protein L25, Ctc-form. The C-terminal domain of sll1824, an apparent L25 of Synechocystis PCC6803, matches the N-terminal domain of this family. Examples of L25 and Ctc are not separated by a UPGMA tree built on the region of shared homology. Length = 176 Score = 139 bits (352), Expect = 4e-34 Identities = 62/178 (34%), Positives = 103/178 (57%), Gaps = 3/178 (1%) Query: 8 LSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILTL 67 L R GK +AR +RK G+IPA++YG + + L +K+ K L +T+LTL Sbjct: 1 LEVKSRTSFGKSAARRIRKEGRIPAVVYGKGKENVNLELKSKEFIKYLRKGA-TSTVLTL 59 Query: 68 DIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQGGKL 127 +IG + V+ KDYQ +PV++ +IH DFL+V EG + V VP++ I G+K GG L Sbjct: 60 EIGGKEFKVLVKDYQYNPVTNEVIHVDFLEVVEGVKLKVEVPIKLIGT--PIGVKNGGIL 117 Query: 128 NVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIRLPEKTSSMSQLNITIATIV 185 V + + C +IPD + +D++ L +G+S+ + D+ LP S ++ + + T++ Sbjct: 118 TQVKRRIEVECKPKDIPDFLELDVSSLGVGESLKLSDLELPAGVSFITDDDEVVVTVI 175 >gnl|CDD|180318 PRK05943, PRK05943, 50S ribosomal protein L25; Reviewed. Length = 94 Score = 71.5 bits (176), Expect = 1e-13 Identities = 32/92 (34%), Positives = 47/92 (51%) Query: 7 KLSAVMRDKVGKGSARLLRKNGQIPAIIYGNMSDPKPIALSAKDISKRLYSKNFMTTILT 66 ++A +R + GKG++R LR+ G+ PAIIYG P I L KD+ F ++T Sbjct: 3 TINAEVRPEQGKGASRRLRRAGKFPAIIYGGNEAPVSIVLDHKDVINLQAKAEFYKEVIT 62 Query: 67 LDIGKELVHVIPKDYQLDPVSDILIHADFLQV 98 L I + V V + Q P L H DF++ Sbjct: 63 LVIDGKEVKVKVQAVQRHPFKPKLEHIDFVRA 94 >gnl|CDD|117761 pfam09208, Endonuc-MspI, Restriction endonuclease MspI. Members of this family of prokaryotic restriction endonucleases recognize the palindromic tetranucleotide sequence 5'-CCGG and cleave between the first and second nucleotides, leaving 2 base 5' overhangs. They fold into an alpha/beta architecture, with a five-stranded mixed beta-sheet sandwiched on both sides by alpha-helices. Length = 263 Score = 29.9 bits (67), Expect = 0.43 Identities = 30/141 (21%), Positives = 49/141 (34%), Gaps = 9/141 (6%) Query: 52 SKRLYSKNFMTTILTLDIGKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVR 111 + + Y+ N DI +L+ + D QLD + ++ D ++ G + +R Sbjct: 46 NLKKYNTNAFAQEKYDDISSKLLKALNLDKQLDNILEVTSTDDIGRLINGGSPKTDATIR 105 Query: 112 FINENKSP-----GIKQGGKLNVVCHEVSLLCPANNIPDSITVDLNDLKIGDSIHMEDIR 166 F NK IK K V HE +I + + DLK D Sbjct: 106 FTFHNKESRIVNISIKNTSKKKVSIHEYD----VEDICTGVGISDGDLKELIRKFQNDGS 161 Query: 167 LPEKTSSMSQLNITIATIVAP 187 T Q + T++ P Sbjct: 162 AKLFTPVQKQRLTELDTVLEP 182 >gnl|CDD|162323 TIGR01371, met_syn_B12ind, 5-methyltetrahydropteroyltriglutamate--homocysteine S-methyltransferase. This model describes the cobalamin-independent methionine synthase. A family of uncharacterized archaeal proteins is homologous to the C-terminal region of this family. That family is excluded from this model but, along with this family, belongs to pfam model pfam01717. Length = 750 Score = 27.7 bits (62), Expect = 2.0 Identities = 9/16 (56%), Positives = 13/16 (81%) Query: 31 PAIIYGNMSDPKPIAL 46 P IIYG++S PKP+ + Sbjct: 515 PPIIYGDVSRPKPMTV 530 >gnl|CDD|162307 TIGR01341, aconitase_1, aconitate hydratase 1. This model represents one form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. It is found in bacteria, archaea, and eukaryotic cytosol. It has been shown to act also as an iron-responsive element binding protein in animals and may have the same role in other eukaryotes. Length = 876 Score = 26.7 bits (59), Expect = 4.2 Identities = 17/66 (25%), Positives = 26/66 (39%), Gaps = 5/66 (7%) Query: 66 TLDI-GKELVHVIPKDYQLDPVSDILIHADFLQVSEGSTVTVHVPVRFINENKSPGIKQG 124 TL + G E + I L P ++ + S+G +T +R E + K G Sbjct: 810 TLGLTGDETID-IDGIKDLKPGKEVTVTFT---NSKGEKITFKCVLRIDTEVELDYYKHG 865 Query: 125 GKLNVV 130 G L V Sbjct: 866 GILQYV 871 >gnl|CDD|162236 TIGR01174, ftsA, cell division protein FtsA. This bacterial cell division protein interacts with FtsZ, the bacterial homolog of tubulin. It is an ATP-binding protein and shows structural similarities to actin and heat shock cognate protein 70. Length = 371 Score = 25.7 bits (57), Expect = 7.4 Identities = 8/18 (44%), Positives = 14/18 (77%) Query: 67 LDIGKELVHVIPKDYQLD 84 + +E++HVIP++Y LD Sbjct: 113 IPNDQEILHVIPQEYILD 130 >gnl|CDD|148092 pfam06277, EutA, Ethanolamine utilisation protein EutA. This family consists of several bacterial EutA ethanolamine utilisation proteins. The EutA protein is thought to protect the lyase (EutBC) from inhibition by CNB12. Length = 473 Score = 25.6 bits (57), Expect = 7.4 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 56 YSKNFMTTILTLDIG 70 SK TT+L +DIG Sbjct: 137 LSKEHHTTVLNIDIG 151 >gnl|CDD|182624 PRK10658, PRK10658, putative alpha-glucosidase; Provisional. Length = 665 Score = 25.6 bits (57), Expect = 7.5 Identities = 7/44 (15%), Positives = 16/44 (36%), Gaps = 7/44 (15%) Query: 100 EGSTVTVHVPVRFINENKSPGIKQGGKLNVVCHEVSLLCPANNI 143 + + + V+ P R + E +G L+ + P + Sbjct: 28 QDNELVVYAPPRDVRE-------RGDTLDTPLFTIRFSSPQEGV 64 >gnl|CDD|162029 TIGR00764, lon_rel, lon-related putative ATP-dependent protease. Members of this family from Pyrococcus horikoshii and Pyrococcus abyssi each contain a predicted intein. Length = 608 Score = 25.2 bits (55), Expect = 9.9 Identities = 22/64 (34%), Positives = 27/64 (42%), Gaps = 6/64 (9%) Query: 44 IALSAKDISKRLYSKNFMTTILTL---DIGKE---LVHVIPKDYQLDPVSDILIHADFLQ 97 I L K I SK I T +I KE V + K Y + +S+ IH FLQ Sbjct: 434 IVLPIKAIVAPAESKEEGRIIATGKLGEIAKEAVTNVSALIKKYTGEDISNYDIHIQFLQ 493 Query: 98 VSEG 101 EG Sbjct: 494 TYEG 497 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0710 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,975,311 Number of extensions: 178418 Number of successful extensions: 348 Number of sequences better than 10.0: 1 Number of HSP's gapped: 345 Number of HSP's successfully gapped: 27 Length of query: 191 Length of database: 5,994,473 Length adjustment: 88 Effective length of query: 103 Effective length of database: 4,092,969 Effective search space: 421575807 Effective search space used: 421575807 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (24.6 bits)