>cd04478 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds corresponding to the OB fold of the central ssDNA-binding domain (DBD)-D of human RPA2 (also called RPA32). RPA2 is a subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B; RPA2 DBD-D is a weak ssDNA-binding domain. RPA2 DBD-D is also involved in trimerization. The ssDNA binding mechanism is believed to be multistep and to involve conformational change. N-terminal to human RPA2 DBD-D is a domain containing all the known phosphorylation sites of RPA. Human RPA2 is phosphorylated in a cell cycle dependent manner in response to DNA dam

Probab=95.39 E-value=0.25 Score=28.93 Aligned_cols=76 Identities=21% Similarity=0.178 Sum_probs=53.9 Q ss_pred EEEEEEEECCCCCCCCEEEEEEECCCCEEEEEE--CCCCHHHHHHHCCCCCCEEEEEEEEEECCCCCCCCCCCCCEEEEE Q ss_conf 899997980044469879999977982599997--488157899852898858999999997586555887778659999 Q gi|254780419|r 20 FVRLSGWVHRVRPHGGIIFLDIRDHYGITQVVA--NPDSACFEIAKSVRSEWVLCIDGLVMSRSAETINANIITGQIELS 97 (622) Q Consensus 20 ~V~i~GwV~~~R~~g~l~F~~lrD~sG~~Q~v~--~~~~~~~~~~~~l~~esvv~v~G~V~~r~~~~~n~~~~tG~~Ei~ 97 (622) T Consensus 1 ~V~~VG~V~~v~~~~t~~~y~idDgTG~i~~~~w~~~~~~~~~~~~~i~~g~YVrV~G~lk~f----------~~~~~I~ 70 (95) T cd04478 1 QVTLVGVVRNVEEQSTNITYTIDDGTGTIEVRQWLDDDNDDSSEVEPIEEGTYVRVFGNLKSF----------QGKKSIM 70 (95) T ss_pred CEEEEEEEEEEEECCCEEEEEEECCCCCEEEEEECCCCCCCCCCCCCCCCCCEEEEEEEEEEE----------CCEEEEE T ss_conf 989999999877725579999987987399999637787642224433269899999998002----------8913799 Q ss_pred EEEEEEEE Q ss_conf 88999950 Q gi|254780419|r 98 AQKIEILS 105 (622) Q Consensus 98 ~~~~~il~ 105 (622) T Consensus 71 ~~~irpv~ 78 (95) T cd04478 71 AFSIRPVT 78 (95) T ss_pred EEEEEEEC T ss_conf 99999937

HHsearch alignment for GI: 254780419 and conserved domain: cd04478