HHsearch alignment for GI: 254780420 and conserved domain: PRK05665

>PRK05665 amidotransferase; Provisional.
Probab=99.72  E-value=1.7e-16  Score=136.86  Aligned_cols=122  Identities=27%  Similarity=0.433  Sum_probs=83.1

Q ss_pred             CCCEEEECCCCCCCCCCCCC---CHHHHHHHCCCCCCEEEEECHHHHHHHHCCCCCCCCCCCC-CCCCCCCEECCCCE--
Q ss_conf             57889985888884101121---1012221025786347861005887875285446677675-21011234778970--
Q gi|254780420|r  246 QPDGVLLSNGPGDPAVTSVY---SSPIICKLVDSGMPMFGICLGHQLLGLALGAQTVKMYQGH-HGVNHPVKNISNGT--  319 (396)
Q Consensus       246 ~pdgi~lSnGPGdP~~~~~~---~~~~~~~~~~~~iPilGIClGhQ~l~~a~G~~~~kl~~Gh-rG~N~Pv~~~~t~k--  319 (396)
T Consensus        57 ~~dg~vITGS~~~vyd~~pWi~~L~~~i~~~~~~~~pilGICfGHQliA~ALGG~V~~~~~Gw~vG~-~~~~~~~~~~~~  135 (240)
T PRK05665         57 KFDAYLVTGSKADSFGTDPWIQTLKTYLLKLYERGDKLLGVCFGHQLLALLLGGKAERASQGWGVGI-HRYQLAAHAPWM  135 (240)
T ss_pred             HCCEEEEECCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEEEHHHHHHHHHHCCEEEECCCCCEEEE-EEEEECCCCCCC
T ss_conf             8789999589874689967699999999999876999899944368888860983612799736667-998875877433


Q ss_pred             -----EEEECCCCCEEEEHHHCCCCCEEEEEECCCCE-EEEEEECCCCEEEECCCCCCCC
Q ss_conf             -----99961457615703436998289999889980-8726867997789834878877
Q gi|254780420|r  320 -----VEIVSMNHGFAIDASSLPAGLEETHISLFDSS-NCGFRLIDQPVFSVQYHPESSP  373 (396)
Q Consensus       320 -----v~iTsqNHg~~v~~~slp~~~~v~~~~~nD~t-iegi~~~~~~~~~vQfHPEa~P  373 (396)
T Consensus       136 ~~~~~~~~l~~~H~D~V~--~lP~ga~~Lass--~~cp~q~~~~~-~~~~~~Q~HPEf~~  190 (240)
T PRK05665        136 SPAVTELTLLISHQDQVT--ALPEGATVIASS--DFCPNAAYHIR-DQVLCFQGHPEFVH  190 (240)
T ss_pred             CCCCCCCEEEEEECCEEE--ECCCCEEEEEEC--CCCCHHHEECC-CCEEEEECCCCCCH
T ss_conf             587564079977224278--579984899867--99833342627-86899916968799