BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780423|ref|YP_003064836.1| S-adenosylmethionine synthetase [Candidatus Liberibacter asiaticus str. psy62] (413 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780423|ref|YP_003064836.1| S-adenosylmethionine synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 413 Score = 846 bits (2186), Expect = 0.0, Method: Compositional matrix adjust. Identities = 413/413 (100%), Positives = 413/413 (100%) Query: 1 MSADFLFTSESVSEGHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVI 60 MSADFLFTSESVSEGHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVI Sbjct: 1 MSADFLFTSESVSEGHPDKICDRISDEIVDLVYREAIESKMDVNSVRVACEVLVTKNKVI 60 Query: 61 VAGEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGYEQEGFHWETVDVEVLLHSQ 120 VAGEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGYEQEGFHWETVDVEVLLHSQ Sbjct: 61 VAGEVRLPHGLSKKDSITGQYVVDKEKFEKVVRSVIRSIGYEQEGFHWETVDVEVLLHSQ 120 Query: 121 SSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSG 180 SSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSG Sbjct: 121 SSDIAYGVDNASDDCSTLGAGDQGIMFGYACRETADFMPAPIYYAHRILRTLADARKNSG 180 Query: 181 GDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDI 240 GDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDI Sbjct: 181 GDVSKLGPDAKSQVTIRYVDNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDI 240 Query: 241 KISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAA 300 KISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAA Sbjct: 241 KISPDCSWYINPAGKFVIGGPCSDAGLTGRKIIVDTYGGASPHGGGAFSGKDITKVDRAA 300 Query: 301 AYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMD 360 AYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMD Sbjct: 301 AYAARYLAKNIVAAGLADRCTIQLSYAIGISRPLSIFVDLHDSGKVSESCVANAINKVMD 360 Query: 361 LSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF 413 LSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF Sbjct: 361 LSVSGIRDHLNLSRPIYAQTSAYGHFGRSANQDGFFPWEALDLIEPLKKAIGF 413 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 23.5 bits (49), Expect = 6.3, Method: Compositional matrix adjust. Identities = 14/64 (21%), Positives = 30/64 (46%), Gaps = 5/64 (7%) Query: 200 DNKVCEVKSIVLSIQHFDPTWDRGKVRSVVEPYILKALEDIKISPDCSWYINPAGKFVIG 259 D+ + +K ++ H D + ++P K LE++K+ D ++ + +G+F I Sbjct: 690 DSSIASIKQWIVDFSHLQD--DFNDINIHLDP---KKLEELKVGKDIPYFPDLSGEFGIS 744 Query: 260 GPCS 263 S Sbjct: 745 AESS 748 >gi|254780967|ref|YP_003065380.1| probable multidrug resistance transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 398 Score = 23.5 bits (49), Expect = 6.3, Method: Compositional matrix adjust. Identities = 13/54 (24%), Positives = 24/54 (44%) Query: 332 RPLSIFVDLHDSGKVSESCVANAINKVMDLSVSGIRDHLNLSRPIYAQTSAYGH 385 RPL+++ LH + + + N L++ I +N S+ IY G+ Sbjct: 189 RPLNLYAILHSFSLIFKHRASTLYNIANSLTMGAILGFVNSSQQIYVGIYQLGN 242 >gi|254780716|ref|YP_003065129.1| 6-phosphogluconate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 475 Score = 23.5 bits (49), Expect = 7.0, Method: Compositional matrix adjust. Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 4/35 (11%) Query: 211 LSIQHFDPTWDRGKVRSVVEPYILKALEDIKISPD 245 L I H WD GK+ S Y++K +I S D Sbjct: 214 LEISHLFSKWDTGKLSS----YLIKITAEILSSSD 244 >gi|254781134|ref|YP_003065547.1| hypothetical protein CLIBASIA_05180 [Candidatus Liberibacter asiaticus str. psy62] Length = 320 Score = 23.5 bits (49), Expect = 7.3, Method: Compositional matrix adjust. Identities = 14/39 (35%), Positives = 17/39 (43%) Query: 274 VDTYGGASPHGGGAFSGKDITKVDRAAAYAARYLAKNIV 312 V YGG +P +FS K I + R A KN V Sbjct: 34 VAVYGGDNPDDSSSFSLKAIYHIGRPLGKRAIVFVKNDV 72 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.136 0.403 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 265,457 Number of Sequences: 1233 Number of extensions: 11096 Number of successful extensions: 30 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 27 Number of HSP's gapped (non-prelim): 7 length of query: 413 length of database: 328,796 effective HSP length: 76 effective length of query: 337 effective length of database: 235,088 effective search space: 79224656 effective search space used: 79224656 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 39 (19.6 bits)