BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780424|ref|YP_003064837.1| transcriptional regulator protein [Candidatus Liberibacter asiaticus str. psy62] (144 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780424|ref|YP_003064837.1| transcriptional regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 144 Score = 291 bits (744), Expect = 4e-81, Method: Compositional matrix adjust. Identities = 144/144 (100%), Positives = 144/144 (100%) Query: 1 MVGNKKIPNPVDINVGKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKGVNRVGASRLQ 60 MVGNKKIPNPVDINVGKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKGVNRVGASRLQ Sbjct: 1 MVGNKKIPNPVDINVGKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKGVNRVGASRLQ 60 Query: 61 HISEVLESPISFFFDVSPTVCSDISSEENNVMDFISTPDGLQLNRYFIQIDDVKVRQKII 120 HISEVLESPISFFFDVSPTVCSDISSEENNVMDFISTPDGLQLNRYFIQIDDVKVRQKII Sbjct: 61 HISEVLESPISFFFDVSPTVCSDISSEENNVMDFISTPDGLQLNRYFIQIDDVKVRQKII 120 Query: 121 ELVRSIVSSEKKYRTIEEECMVEQ 144 ELVRSIVSSEKKYRTIEEECMVEQ Sbjct: 121 ELVRSIVSSEKKYRTIEEECMVEQ 144 >gi|254781218|ref|YP_003065631.1| hypothetical protein CLIBASIA_05625 [Candidatus Liberibacter asiaticus str. psy62] Length = 205 Score = 30.0 bits (66), Expect = 0.016, Method: Compositional matrix adjust. Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 2/49 (4%) Query: 2 VGNKKIPNPVDINVGKRIRLRRMILGMSQEKLGECLGITFQQVQKYEKG 50 V NKK +P I G R++ R GMSQ + G+ LG+ + YE+G Sbjct: 103 VTNKKRLDPYAI--GARLKSIRKDKGMSQIEFGKLLGMPNSTLSNYEQG 149 >gi|254780539|ref|YP_003064952.1| ABC transporter, membrane spanning protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 273 Score = 25.8 bits (55), Expect = 0.36, Method: Compositional matrix adjust. Identities = 13/29 (44%), Positives = 15/29 (51%) Query: 50 GVNRVGASRLQHISEVLESPISFFFDVSP 78 G V +S L S L S IS+F D SP Sbjct: 219 GTYLVSSSLLGATSSFLGSYISYFLDCSP 247 >gi|254780644|ref|YP_003065057.1| hypothetical protein CLIBASIA_02655 [Candidatus Liberibacter asiaticus str. psy62] Length = 289 Score = 25.4 bits (54), Expect = 0.46, Method: Compositional matrix adjust. Identities = 10/41 (24%), Positives = 17/41 (41%) Query: 71 SFFFDVSPTVCSDISSEENNVMDFISTPDGLQLNRYFIQID 111 SFF P + +S EE + + P+ ++F D Sbjct: 21 SFFMQAKPYILPALSKEEQKSLKYFFLPENTLCQKFFNAFD 61 >gi|254780911|ref|YP_003065324.1| formyltetrahydrofolate deformylase [Candidatus Liberibacter asiaticus str. psy62] Length = 288 Score = 23.5 bits (49), Expect = 1.6, Method: Compositional matrix adjust. Identities = 11/26 (42%), Positives = 14/26 (53%) Query: 45 QKYEKGVNRVGASRLQHISEVLESPI 70 Q YE GV +GA+ I E+ PI Sbjct: 203 QAYEYGVKIIGATAHYAICELDAGPI 228 >gi|254780343|ref|YP_003064756.1| probable cation efflux protein [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Score = 23.1 bits (48), Expect = 2.0, Method: Compositional matrix adjust. Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 10/64 (15%) Query: 65 VLESPISFFF--DVSPTVCSDISSEENNVMDFISTPDGLQ-------LNRY-FIQIDDVK 114 VL+S I+ F ++ C ISS N+MD P+ L+ LN I I D+K Sbjct: 178 VLDSIIACFMACNILYQGCKVISSSIKNLMDAAVKPEHLEKIKNIIALNASGSIGIHDLK 237 Query: 115 VRQK 118 +RQ Sbjct: 238 IRQA 241 >gi|254780281|ref|YP_003064694.1| cytochrome-c oxidase assembly factor protein [Candidatus Liberibacter asiaticus str. psy62] Length = 201 Score = 22.7 bits (47), Expect = 3.1, Method: Compositional matrix adjust. Identities = 8/14 (57%), Positives = 9/14 (64%) Query: 98 PDGLQLNRYFIQID 111 P G LN YFI +D Sbjct: 88 PTGTLLNAYFITVD 101 >gi|255764463|ref|YP_003064765.2| delta-aminolevulinic acid dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 337 Score = 21.9 bits (45), Expect = 4.4, Method: Compositional matrix adjust. Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 5/88 (5%) Query: 39 ITFQQVQKYEKGVNRVGAS-----RLQHISEVLESPISFFFDVSPTVCSDISSEENNVMD 93 I+ V + + G + + S R+Q I + L+S + P V SS D Sbjct: 158 ISHAAVIQADAGADIIAPSEMMDGRVQEIRKKLDSHGHINVGIMPYVAKFNSSFYGPYRD 217 Query: 94 FISTPDGLQLNRYFIQIDDVKVRQKIIE 121 IST D L+ ++ +D V++ I E Sbjct: 218 AISTRDLLKGDKKTYYLDPANVQEAIRE 245 >gi|254780271|ref|YP_003064684.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Score = 21.6 bits (44), Expect = 6.5, Method: Compositional matrix adjust. Identities = 11/31 (35%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 60 QH-ISEVLESPISFFFDVSPTVCSDISSEEN 89 QH + +++ P F D +C DI EEN Sbjct: 24 QHEVRKLIAGPTVFICDECVELCMDIIREEN 54 >537021.9.peg.911_1 Length = 47 Score = 21.6 bits (44), Expect = 6.9, Method: Composition-based stats. Identities = 7/12 (58%), Positives = 10/12 (83%) Query: 43 QVQKYEKGVNRV 54 QV++Y KG NR+ Sbjct: 6 QVERYAKGANRI 17 >gi|254780256|ref|YP_003064669.1| 50S ribosomal protein L22 [Candidatus Liberibacter asiaticus str. psy62] Length = 131 Score = 21.6 bits (44), Expect = 7.0, Method: Compositional matrix adjust. Identities = 7/16 (43%), Positives = 12/16 (75%) Query: 75 DVSPTVCSDISSEENN 90 +V T+CS +++ ENN Sbjct: 60 EVRKTLCSAVANAENN 75 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.137 0.378 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 91,399 Number of Sequences: 1233 Number of extensions: 3439 Number of successful extensions: 19 Number of sequences better than 100.0: 16 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 5 Number of HSP's that attempted gapping in prelim test: 8 Number of HSP's gapped (non-prelim): 16 length of query: 144 length of database: 328,796 effective HSP length: 66 effective length of query: 78 effective length of database: 247,418 effective search space: 19298604 effective search space used: 19298604 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 34 (17.7 bits)