>cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain. Members of CAP_ED, include CAP which binds cAMP, FNR (fumarate and nitrate reductase) which uses an iron-sulfur cluster to sense oxygen, and CooA a heme containing CO sensor. In all cases binding of the effector leads to conformational changes and the ability to activate transcription. DUF294 is a putative nucleotidyltransferase with a conserved DxD motif. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or

Probab=99.34 E-value=1.4e-11 Score=95.81 Aligned_cols=108 Identities=15% Similarity=0.181 Sum_probs=94.3 Q ss_pred EEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHHHHCCCCCCCCCCCCCCCHHHHC-CCCEEECC Q ss_conf 29998630103677897986598179984188664224102999998766223564322333457678851-56579717 Q gi|254780426|r 98 SINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSESNLI-KNILFVPS 176 (320) Q Consensus 98 ~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~~~~~~~~~~~~~~~~~~l~~~~-r~~~~Vpe 176 (320) T Consensus 2 ~pvtv~~~~ti~ea~~~M~~~~i~~~vV~~~~--~~~GIvT~~Dl~~~~~~~~~-------~~~~~V~~vms~~~~ti~~ 72 (111) T cd04589 2 PPLIVDASTSIRDAARLMREHGADALLVRDGD--PRLGIVTRTDLLDAVLLDGL-------PSSTPVGEIATFPLITVDP 72 (111) T ss_pred CCEEECCCCCHHHHHHHHHHCCCCEEEEEECC--EEEEEEEHHHHHHHHHCCCC-------CCCCCHHHHCCCCCEEECC T ss_conf 99899992989999999997099889997699--27999997998999982999-------6788999928799989999 Q ss_pred CCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHH Q ss_conf 885123234320135651165407766204667588999 Q gi|254780426|r 177 SMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVS 215 (320) Q Consensus 177 ~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle 215 (320) T Consensus 73 ~~~~~~a~~~M~~~~i~~lpV~d~-~~~vGivt~~Dil~ 110 (111) T cd04589 73 DDFLFNALLLMTRHRIHRVVVREG-GEVVGVLEQTDLLS 110 (111) T ss_pred CCCHHHHHHHHHHCCCEEEEEEEC-CEEEEEEEHHHHHC T ss_conf 792999999999879808899989-99999999688228

HHsearch alignment for GI: 254780426 and conserved domain: cd04589