>cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein. These APIs catalyze the conversion of the pentose pathway intermediate D-ribulose 5-phosphate into A5P, a precursor of 3-deoxy-D-manno-octulosonate, which is an integral carbohydrate component of various glycolipids coating the surface of the outer membrane of Gram-negative bacteria, including lipopolysaccharide and many group 2 K-antigen capsules. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other funct

Probab=97.94 E-value=1.2e-05 Score=56.88 Aligned_cols=83 Identities=17% Similarity=0.246 Sum_probs=51.4 Q ss_pred CCEEECCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHHHHHHHHHHHCCCHHHCCCCCCCCEEEEECCCCHH Q ss_conf 65797178851232343201356511654077662046675889999874222100000000124677337830453599 Q gi|254780426|r 170 NILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDLE 249 (320) Q Consensus 170 ~~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle~ivGei~de~d~~~~~i~~~~~g~~~v~G~~~l~ 249 (320) T Consensus 3 ~vp~V~~~~si~ea~~~m~~~~~~~v~Vvd~~~~lvGiiT~~Dl~r~~~~~~~~~~~-~v~~iM--~~~~~tv~~~~~i~ 79 (114) T cd04604 3 ALPLVSPDTSLKDALLEMSRKGLGMTAVVDEDGRLVGIFTDGDLRRALEKGLDILTL-PVADVM--TRNPKTIDPDALAA 79 (114) T ss_pred CCCEECCCCCHHHHHHHHHHCCCCEEEEECCCCEEEEEEEHHHHHHHHHCCCCCCCC-CHHHHH--CCCCEEEECCCCHH T ss_conf 477889949399999999976997899997999399999899999998716664567-974743--56758993898869 Q ss_pred HHHHHH Q ss_conf 999982 Q gi|254780426|r 250 ELAKII 255 (320) Q Consensus 250 ~l~~~l 255 (320) T Consensus 80 ~a~~~m 85 (114) T cd04604 80 EALELM 85 (114) T ss_pred HHHHHH T ss_conf 999999

HHsearch alignment for GI: 254780426 and conserved domain: cd04604