>cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener

Probab=98.14 E-value=1e-05 Score=57.37 Aligned_cols=83 Identities=18% Similarity=0.293 Sum_probs=58.8 Q ss_pred CCCEEECCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHHHHHHHHHHHCCCHHHCCCCCCCCEEEEECCCCH Q ss_conf 56579717885123234320135651165407766204667588999987422210000000012467733783045359 Q gi|254780426|r 169 KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL 248 (320) Q Consensus 169 r~~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle~ivGei~de~d~~~~~i~~~~~g~~~v~G~~~l 248 (320) T Consensus 1 r~vvtv~~~~tl~ea~~~m~~~~~~~~~Vvd~~~~lvGiiT~~Di~~~~~~~~~~----~~~v~~~m~~~~~tv~~~~~l 76 (112) T cd04624 1 RPVVTVDPDTSIREAAKLMAEENVGSVVVVDPDERPIGIVTERDIVRAVAAGIDL----DTPVSEIMTRDLVTVDPDEPV 76 (112) T ss_pred CCCEEECCCCCHHHHHHHHHHCCCCEEEEECCCCCEEEEEECCHHHHHHHCCCCC----CCCEEEEECCCCEEECCCCCH T ss_conf 9978978939599999999862998899993998299999820458898648743----442045651671678799989 Q ss_pred HHHHHHH Q ss_conf 9999982 Q gi|254780426|r 249 EELAKII 255 (320) Q Consensus 249 ~~l~~~l 255 (320) T Consensus 77 ~~a~~~m 83 (112) T cd04624 77 AEAAKLM 83 (112) T ss_pred HHHHHHH T ss_conf 9999999

HHsearch alignment for GI: 254780426 and conserved domain: cd04624