>cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener

Probab=99.44 E-value=5.7e-13 Score=104.86 Aligned_cols=116 Identities=15% Similarity=0.245 Sum_probs=96.0 Q ss_pred CEEEEEEECCCHHHHHHHHHHCCCCEEEEECCCCCCCCCCEEHHHHHHHHHHCCCCC----------------------- Q ss_conf 129998630103677897986598179984188664224102999998766223564----------------------- Q gi|254780426|r 97 VSINAVEDKATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKT----------------------- 153 (320) Q Consensus 97 ~~i~~i~~~~~~~e~~~~i~~~~~sR~PV~~~~~d~iiGiv~~kDll~~~~~~~~~~----------------------- 153 (320) T Consensus 1 kdvvTv~~d~~l~ea~~~m~~~~i~~lPVvd~--~~lvGivT~~Dil~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 78 (143) T cd04634 1 KNPITCNADDTISDAARLLRENKISGAPVLDG--GKLVGIVSESDILKLLVTHDPSGNLWLPSPLELIELPLREFINWEE 78 (143) T ss_pred CCCEEECCCCCHHHHHHHHHHHCCCEEEEEEC--CEEEEEEEHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHH T ss_conf 99889589398999999999749977999979--9999999869999887516755432356602332111232222667 Q ss_pred --CCCCCCCCCCHHHHC-CCCEEECCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHH Q ss_conf --322333457678851-56579717885123234320135651165407766204667588999 Q gi|254780426|r 154 --NNINLNIQLSESNLI-KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVS 215 (320) Q Consensus 154 --~~~~~~~~~~l~~~~-r~~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle 215 (320) T Consensus 79 ~~~~~~~~~~~~v~diM~~~~itv~~~~~l~~a~~~m~~~~i~~lPVvd~-~~lvGIItr~Dilk 142 (143) T cd04634 79 TKRALTDAGKMKVRDIMTKKVITISPDASIEDAAELMVRHKIKRLPVVED-GRLVGIVTRGDIIE 142 (143) T ss_pred HHHHHHHHCCCCHHHHCCCCCEEECCCCCHHHHHHHHHHCCCCEEEEEEC-CEEEEEEEHHHCCC T ss_conf 77665432278989958889879989896999999999739888999989-99999999577308

HHsearch alignment for GI: 254780426 and conserved domain: cd04634