>cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins. CBS domains usually occur in tandem repeats. They associate to form a so-called Bateman domain or a CBS pair based on crystallographic studies in bacteria. The CBS pair was used as a basis for this cd hierarchy since the human CBS proteins can adopt the typical core structure and form an intramolecular CBS pair. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains and this has been used to help in its classification here. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain are associated with a variety of human hereditary diseases, including congenital myotonia, idiopathic gener

Probab=98.19 E-value=5.2e-06 Score=59.25 Aligned_cols=113 Identities=13% Similarity=0.228 Sum_probs=64.6 Q ss_pred CCCEEECCCCCHHHHHHHHHCCCCCCEEEEECCCCCEEEEEHHHHHHHHHHHHHHHCCCHHHCCCCCCCCEEEEECCCCH Q ss_conf 56579717885123234320135651165407766204667588999987422210000000012467733783045359 Q gi|254780426|r 169 KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDIVSVLMRDITSEHHSKKSMISAVSDNTFIVDARTDL 248 (320) Q Consensus 169 r~~~~Vpe~~~l~~lL~~m~~~~~~~aiVvDE~G~~~GiVTleDIle~ivGei~de~d~~~~~i~~~~~g~~~v~G~~~l 248 (320) T Consensus 1 rdvvtv~~~~tl~ea~~~m~~~~~~~lpVvd~~~~lvGiit~~Dll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v 80 (132) T cd04636 1 KDVITVKKDDTLRDVVEILLTGKISGVPVVDNEGRVVGIVSEGDLIRKIYKGKGLFYVTLLYSVIFLDESKIKKLLGKKV 80 (132) T ss_pred CCCEEECCCCCHHHHHHHHHHCCCCEEEEECCCCCEEEEEEHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHCCCCCCCH T ss_conf 99879689197999999999729978999959993999988899999986267620000000000002333102038999 Q ss_pred HHHHHHHCCCCCCCCCCCCCCCHHHHHHH-HHCCCCC Q ss_conf 99999828888877774674317999999-8423473 Q gi|254780426|r 249 EELAKIIGTDCNCLKGEQDVDSLGGLIFS-VLDRIPA 284 (320) Q Consensus 249 ~~l~~~l~~~l~~~~~~~~~~Ti~G~i~~-~l~~iP~ 284 (320) T Consensus 81 ~di---Mt~~~~tv~~~~~l~~a~~~m~~~~i~~lpV 114 (132) T cd04636 81 EEI---MTKKVITVDEDTTIEDVARIMSKKNIKRLPV 114 (132) T ss_pred HHH---CCCCCEEECCCCCHHHHHHHHHHCCCCEEEE T ss_conf 996---7899879999794999999999629878999

HHsearch alignment for GI: 254780426 and conserved domain: cd04636