RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780430|ref|YP_003064843.1| nitrogen fixation protein [Candidatus Liberibacter asiaticus str. psy62] (189 letters) >d1veha_ d.52.8.1 (A:) HIRA-interacting protein 5, HIRIP5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Score = 104 bits (260), Expect = 6e-24 Identities = 38/78 (48%), Positives = 56/78 (71%) Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171 E D VV IKE+LD R+RP V DGGD++++G+ DGIV L ++G+C+ CPS+ TLK G Sbjct: 9 EEDDEVVAMIKELLDTRIRPTVQEDGGDVIYRGFEDGIVRLKLQGSCTSCPSSIITLKSG 68 Query: 172 VANILNHFVPEVKDIRTV 189 + N+L ++PEV+ + V Sbjct: 69 IQNMLQFYIPEVEGVEQV 86 >d2ffma1 d.267.1.1 (A:1-83) Hypothetical protein SAV1430 {Staphylococcus aureus [TaxId: 1280]} Length = 83 Score = 99.1 bits (247), Expect = 2e-22 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 2/78 (2%) Query: 1 MFIQTEDTPNPATLKFIPGQVVLVEGAIHFSNAKEAEISPLASRIFSIPGIASVYFGYDF 60 I +TPN T+K + + ++ +++ + I + G+ S++ DF Sbjct: 2 KIISISETPNHNTMKITLSESREGMTSDTYTKVDDSQ-PAFINDILKVEGVKSIFHVMDF 60 Query: 61 ITVGK-DQYDWEHLRPPV 77 I+V K + +WE + P V Sbjct: 61 ISVDKENDANWETVLPKV 78 >d1xhja_ d.52.8.1 (A:) Nitrogen fixation protein NifU homolog SE0630 {Staphylococcus epidermidis [TaxId: 1282]} Length = 88 Score = 95.3 bits (237), Expect = 3e-21 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 1/78 (1%) Query: 112 ESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYG 171 + + ++ EV++ R+RP + RDGGD DGIV L + GAC CPS++ TLK G Sbjct: 3 TENPTMFDQVAEVIE-RLRPFLLRDGGDCTLVDVEDGIVKLQLHGACGTCPSSTITLKAG 61 Query: 172 VANILNHFVPEVKDIRTV 189 + L+ VP V ++ V Sbjct: 62 IERALHEEVPGVIEVEQV 79 >d1th5a1 d.52.8.1 (A:154-226) NifU-like protein 1, NIFUL1 {Rice (Oryza sativa) [TaxId: 4530]} Length = 73 Score = 74.0 bits (182), Expect = 8e-15 Identities = 14/72 (19%), Positives = 34/72 (47%), Gaps = 6/72 (8%) Query: 119 QRIKEVLDNRVRP-AVARDGGDIVFKGYRDGIVFLSMRGACSGCPSASETLKYGVANILN 177 + +++VL+ +RP GG + F + IV + + G + T++ V+ L Sbjct: 6 ENVEKVLN-EIRPYLAGTGGGGLQFLMIKGPIVKVRLTGPAAVVR----TVRIAVSKKLR 60 Query: 178 HFVPEVKDIRTV 189 +P ++ ++ + Sbjct: 61 EKIPSIQIVQLL 72 >d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Length = 516 Score = 25.0 bits (54), Expect = 4.1 Identities = 16/73 (21%), Positives = 27/73 (36%), Gaps = 8/73 (10%) Query: 93 HNGGLGDMKLDDMGSGDFIESDSAVVQRIKEVLDNRVRPAVARDGGDIVFKGYRDGIVFL 152 H G + ++ D S S V+R ++ D + K Y DG+++L Sbjct: 298 HQGDVAPREVGLFYFPDAFNSPSNYVRR-------QIPSEYEPDASEPCIKYY-DGVLYL 349 Query: 153 SMRGACSGCPSAS 165 RG +S Sbjct: 350 ITRGTRGDRLGSS 362 >d2fb5a1 d.320.1.1 (A:5-205) Hypothetical protein BC4920 (YojJ) {Bacillus cereus [TaxId: 1396]} Length = 201 Score = 24.4 bits (53), Expect = 6.5 Identities = 6/23 (26%), Positives = 10/23 (43%) Query: 165 SETLKYGVANILNHFVPEVKDIR 187 SE LK ++ E+ +R Sbjct: 7 SEELKIQTKQMIEIAEKELSIMR 29 >d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Length = 406 Score = 24.3 bits (51), Expect = 7.5 Identities = 6/46 (13%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Query: 29 HFSNAKEAEISPLASRIFSIPGIASVYFGYDF-ITVGKDQYDWEHL 73 ++ + + + G+ ++Y+G + +T D Y+ + Sbjct: 333 FYNGGSTRPVEQALAFTLTSRGVPAIYYGTEQYMTGNGDPYNRAMM 378 >d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Length = 357 Score = 24.1 bits (51), Expect = 8.7 Identities = 8/28 (28%), Positives = 11/28 (39%), Gaps = 8/28 (28%) Query: 45 IFSIPGIASVYFGYDFITVGKDQYDWEH 72 I + PG VY+ YDW + Sbjct: 322 ILTSPGTPVVYWD--------HMYDWGY 341 >d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 361 Score = 24.1 bits (51), Expect = 8.7 Identities = 4/28 (14%), Positives = 10/28 (35%), Gaps = 8/28 (28%) Query: 45 IFSIPGIASVYFGYDFITVGKDQYDWEH 72 I + G +++ D +W + Sbjct: 303 ILTYEGQPVIFYR--------DFEEWLN 322 >d1s14a_ d.122.1.2 (A:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]} Length = 168 Score = 24.0 bits (52), Expect = 9.1 Identities = 10/45 (22%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Query: 121 IKEVLDNRVRPAVARDGGDIVFKGYRDGIVFLSMRGACSGCPSAS 165 +EV+DN V A+A + + D + + G P Sbjct: 10 GQEVIDNSVDEALAGHAKRVDVILHADQSLEVIDD--GRGMPVDI 52 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.322 0.142 0.424 Gapped Lambda K H 0.267 0.0400 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 749,701 Number of extensions: 35361 Number of successful extensions: 101 Number of sequences better than 10.0: 1 Number of HSP's gapped: 98 Number of HSP's successfully gapped: 16 Length of query: 189 Length of database: 2,407,596 Length adjustment: 80 Effective length of query: 109 Effective length of database: 1,309,196 Effective search space: 142702364 Effective search space used: 142702364 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)