RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780431|ref|YP_003064844.1| hypothetical protein CLIBASIA_01580 [Candidatus Liberibacter asiaticus str. psy62] (178 letters) >gnl|CDD|116364 pfam07750, GcrA, GcrA cell cycle regulator. GcrA is a master cell cycle regulator that, together with CtrA (see pfam00072 and pfam00486), is involved in controlling cell cycle progression and asymmetric polar morphogenesis. During this process, there are temporal and spatial variations in the concentrations of GcrA and CtrA. The variation in concentration produces time and space dependent transcriptional regulation of modular functions that implement cell-cycle processes. More specifically, GcrA acts as an activator of components of the replisome and the segregation machinery. Length = 162 Score = 166 bits (423), Expect = 2e-42 Identities = 75/177 (42%), Positives = 98/177 (55%), Gaps = 20/177 (11%) Query: 1 MVWTVERIDKLKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGN 60 M WT ER++ LKK W EGLSASQIA QLGGV+RNAVIGK+HRL LS R K + Sbjct: 1 MNWTDERVELLKKLWLEGLSASQIAAQLGGVSRNAVIGKVHRLGLSGRAKPMSPTAAPAR 60 Query: 61 RKNVTLGSTSPKTRQSSNV----YICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPI 116 K + +P+ E L+ PVV IV+P+ Sbjct: 61 PKRAGPPAAAPRPSAGRTALQLELPAEVALEPAAPVVE----------------RIVVPM 104 Query: 117 SRCLRLMELTDNTCKWPLGDPFGKDFSFCGSDVCNDSPYCDYHKKLAYQRVNDRRKV 173 R L+L+EL + TC+WP+GDP +DF+FCG+ SPYC H +LAYQ +RR++ Sbjct: 105 PRRLQLLELGEATCRWPIGDPLSEDFAFCGNKSSEGSPYCAPHARLAYQPGAERRRM 161 >gnl|CDD|132034 TIGR02989, Sig-70_gvs1, RNA polymerase sigma-70 factor, Rhodopirellula/Verrucomicrobium family. This group of sigma factors are members of the sigma-70 family (TIGR02937) and are abundantly found in the species Rhodopirellula baltica (11), and Verrucomicrobium spinosum (16) and to a lesser extent in Gemmata obscuriglobus (2). Length = 159 Score = 27.6 bits (62), Expect = 1.8 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 11 LKKFWSEGLSASQIAVQLGGVTRNAVIGKLHRL 43 L+ + G+S + +A QL G T NAV L RL Sbjct: 120 LQLRYQRGVSLTALAEQL-GRTVNAVYKALSRL 151 >gnl|CDD|102352 PRK06389, PRK06389, argininosuccinate lyase; Provisional. Length = 434 Score = 27.2 bits (60), Expect = 2.8 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Query: 67 GSTSP-KTRQSSNVYICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPISR 118 GS S K Q S + E +K PV S K++E + + S + + +SR Sbjct: 196 GSPSSVKFNQMSELLGMEKNIKN--PVYSSSLYIKTIENISYLISSLAVDLSR 246 >gnl|CDD|163078 TIGR02937, sigma70-ECF, RNA polymerase sigma factor, sigma-70 family. Several PFAM models hit segments of these sequences including Sigma-70 region 2 (pfam04542) and Sigma-70, region 4 (pfam04545), but not always above their respective trusted cutoffs. Length = 158 Score = 26.9 bits (60), Expect = 3.1 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Query: 17 EGLSASQIAVQLGGVTRNAVIGKLHR 42 EGLS +IA L G++ V +L R Sbjct: 125 EGLSYKEIAEIL-GISVGTVKRRLKR 149 >gnl|CDD|150108 pfam09329, zf-primase, Primase zinc finger. This zinc finger is found in yeast Mcm10 proteins and DnaG-type primases. Length = 46 Score = 26.5 bits (59), Expect = 4.0 Identities = 9/43 (20%), Positives = 19/43 (44%), Gaps = 11/43 (25%) Query: 140 KDFSFCGS-----DVCN------DSPYCDYHKKLAYQRVNDRR 171 +D C + C + +C+YH + AY++ + +R Sbjct: 4 RDLGTCKAVRKDGKRCTSWVNKRKTEFCEYHVEAAYRKSSSKR 46 >gnl|CDD|163480 TIGR03768, RPA4764, metallophosphoesterase, RPA4764 family. This model describes a small collection of probable metallophosphoresterases, related to pfam00149. Members of this protein family usually have a Sec-independent TAT (twin-arginine translocation) signal sequence, N-terminal to the region modeled by this alignment. This model and TIGR03767 divide a narrow clade of pfam00149-related enzymes. Length = 492 Score = 26.0 bits (57), Expect = 5.0 Identities = 8/20 (40%), Positives = 9/20 (45%), Gaps = 2/20 (10%) Query: 136 DPFGKDFSFCGSDVCNDSPY 155 D F DF D CN + Y Sbjct: 98 DRF--DFGISLGDACNSTQY 115 >gnl|CDD|185491 PTZ00164, PTZ00164, bifunctional dihydrofolate reductase-thymidylate synthase; Provisional. Length = 514 Score = 25.8 bits (57), Expect = 6.6 Identities = 7/24 (29%), Positives = 9/24 (37%) Query: 60 NRKNVTLGSTSPKTRQSSNVYICE 83 NR NV L T + V + Sbjct: 80 NRINVVLSRTLTEEEADPGVLVFG 103 >gnl|CDD|183153 PRK11475, PRK11475, DNA-binding transcriptional activator BglJ; Provisional. Length = 207 Score = 25.5 bits (56), Expect = 7.5 Identities = 9/16 (56%), Positives = 10/16 (62%) Query: 13 KFWSEGLSASQIAVQL 28 +F S G S QIA QL Sbjct: 144 RFMSRGYSMPQIAEQL 159 >gnl|CDD|184617 PRK14317, glmM, phosphoglucosamine mutase; Provisional. Length = 465 Score = 25.3 bits (56), Expect = 8.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Query: 54 NKQSDGNRKNVTLGST 69 + Q DG+R NV GST Sbjct: 219 HDQPDGDRINVNCGST 234 >gnl|CDD|178484 PLN02896, PLN02896, cinnamyl-alcohol dehydrogenase. Length = 353 Score = 25.2 bits (55), Expect = 9.7 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Query: 81 ICEPVLKGQLPVVRSKRKSKSMEKNNTISSGIVLPISRCL-RLMELTDNTCKWPLGD 136 + +P +KG L V++S KSK++++ SS L R + D TC+ P+ Sbjct: 109 VIDPAIKGTLNVLKSCLKSKTVKRVVFTSSISTLTAKDSNGRWRAVVDETCQTPIDH 165 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.317 0.132 0.395 Gapped Lambda K H 0.267 0.0603 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,648,309 Number of extensions: 142778 Number of successful extensions: 243 Number of sequences better than 10.0: 1 Number of HSP's gapped: 242 Number of HSP's successfully gapped: 14 Length of query: 178 Length of database: 5,994,473 Length adjustment: 87 Effective length of query: 91 Effective length of database: 4,114,577 Effective search space: 374426507 Effective search space used: 374426507 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (24.9 bits)