RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780431|ref|YP_003064844.1| hypothetical protein CLIBASIA_01580 [Candidatus Liberibacter asiaticus str. psy62] (178 letters) >1gdt_A GD resolvase, protein (gamma delta resolvase); protein-DNA complex, double helix, overhanging base, DNA binding protein/DNA complex; 3.00A {Escherichia coli} (A:142-183) Length = 42 Score = 27.3 bits (61), Expect = 1.2 Identities = 10/33 (30%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Query: 4 TVERIDKLKKFWSEGLSASQIAVQLGGVTRNAV 36 ++R D + W +GL AS I+ + + R+ V Sbjct: 4 KIDR-DAVLNMWQQGLGASHISKTM-NIARSTV 34 >2q1z_A RPOE, ECF SIGE; ECF sigma factor, cupin fold, zinc binding transcription factor; 2.40A {Rhodobacter sphaeroides 2} PDB: 2z2s_A (A:103-184) Length = 82 Score = 26.0 bits (57), Expect = 3.0 Identities = 3/26 (11%), Positives = 11/26 (42%), Gaps = 1/26 (3%) Query: 17 EGLSASQIAVQLGGVTRNAVIGKLHR 42 L+ ++A + G+ + ++ Sbjct: 48 GDLTHRELAAET-GLPLGTIKSRIRL 72 >1ydh_A AT5G11950; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG; 2.15A {Arabidopsis thaliana} (A:) Length = 216 Score = 26.1 bits (57), Expect = 3.2 Identities = 6/21 (28%), Positives = 9/21 (42%) Query: 144 FCGSDVCNDSPYCDYHKKLAY 164 FCGS + + D +L Sbjct: 15 FCGSHSGHREVFSDAAIELGN 35 >2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerization, cell adhesion; HET: NAG FUC; 2.70A {Homo sapiens} (A:1-99) Length = 99 Score = 25.9 bits (57), Expect = 3.4 Identities = 15/64 (23%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Query: 20 SASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGNRK---NVTLGSTSPKTRQS 76 S +Q+ + LG N + S + V+ + +G ++ V LG+ S +T Q+ Sbjct: 34 SEAQVHLALGDQRLNPTV-TYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQT 92 Query: 77 SNVY 80 +Y Sbjct: 93 VTIY 96 >2a33_A Hypothetical protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT2G37210; 1.95A {Arabidopsis thaliana} (A:) Length = 215 Score = 25.7 bits (56), Expect = 3.5 Identities = 8/21 (38%), Positives = 8/21 (38%) Query: 144 FCGSDVCNDSPYCDYHKKLAY 164 FCGS S Y D L Sbjct: 19 FCGSSQGKKSSYQDAAVDLGN 39 >1xsv_A Hypothetical UPF0122 protein SAV1236; helix-turn-helix, putative DNA-binding protein, signal recognition particle, unknown function; 1.70A {Staphylococcus aureus subsp} (A:1-76) Length = 76 Score = 25.9 bits (57), Expect = 3.8 Identities = 10/26 (38%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Query: 17 EGLSASQIAVQLGGVTRNAVIGKLHR 42 E S S+IA V+R AV + R Sbjct: 40 EDYSLSEIADTF-NVSRQAVYDNIRR 64 >1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} (I:188-283) Length = 96 Score = 25.5 bits (56), Expect = 3.8 Identities = 15/64 (23%), Positives = 29/64 (45%), Gaps = 4/64 (6%) Query: 20 SASQIAVQLGGVTRNAVIGKLHRLFLSNRVKVNENKQSDGNRK---NVTLGSTSPKTRQS 76 S +Q+ + LG N + S + V+ + +G ++ V LG+ S +T Q+ Sbjct: 32 SEAQVHLALGDQRLNPTV-TYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQT 90 Query: 77 SNVY 80 +Y Sbjct: 91 VTIY 94 >1s7o_A Hypothetical UPF0122 protein SPY1201/SPYM3_0842/SPS1042/SPYM18_1152; putative DNA binding protein, structural genomics; 2.31A {Streptococcus pyogenes serotype M3} (A:1-73) Length = 73 Score = 25.4 bits (56), Expect = 4.2 Identities = 9/26 (34%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Query: 17 EGLSASQIAVQLGGVTRNAVIGKLHR 42 + S ++IA + GV+R AV + R Sbjct: 37 DDYSLAEIADEF-GVSRQAVYDNIKR 61 >1t35_A Hypothetical protein YVDD, putative lysine decarboxylase; structural genomics target, NYSGXRC, PSI, protein structure initiative; 2.72A {Bacillus subtilis} (A:) Length = 191 Score = 25.7 bits (56), Expect = 4.2 Identities = 5/21 (23%), Positives = 8/21 (38%) Query: 144 FCGSDVCNDSPYCDYHKKLAY 164 F GS+ + Y +L Sbjct: 7 FAGSNPGGNEAYKRKAAELGV 27 >1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} (A:117-194) Length = 78 Score = 25.5 bits (56), Expect = 4.7 Identities = 7/26 (26%), Positives = 12/26 (46%), Gaps = 1/26 (3%) Query: 17 EGLSASQIAVQLGGVTRNAVIGKLHR 42 +GLS +IA + V ++ R Sbjct: 39 DGLSYEEIAAIM-DCPVGTVRSRIFR 63 >2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn- helix motif; 3.00A {Mycobacterium tuberculosis H37RV} (A:) Length = 70 Score = 25.4 bits (56), Expect = 4.8 Identities = 6/26 (23%), Positives = 10/26 (38%), Gaps = 1/26 (3%) Query: 17 EGLSASQIAVQLGGVTRNAVIGKLHR 42 GLS + A G + ++ R Sbjct: 30 LGLSYADAAAVC-GCPVGTIRSRVAR 54 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.317 0.132 0.395 Gapped Lambda K H 0.267 0.0666 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,242,008 Number of extensions: 48143 Number of successful extensions: 97 Number of sequences better than 10.0: 1 Number of HSP's gapped: 97 Number of HSP's successfully gapped: 13 Length of query: 178 Length of database: 4,956,049 Length adjustment: 83 Effective length of query: 95 Effective length of database: 2,150,234 Effective search space: 204272230 Effective search space used: 204272230 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (23.9 bits)