>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD. NPD is part of the nitroalkaneoxidizing enzyme family, that catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites. NDPs are members of the NAD(P)H-dependent flavin oxidoreductase family that reduce a range of alternative electron acceptors. Most use FAD/FMN as a cofactor and NAD(P)H as electron donor. Some contain 4Fe-4S cluster to transfer electron from FAD to FMN.

Probab=95.98 E-value=0.15 Score=30.27 Aligned_cols=51 Identities=22% Similarity=0.214 Sum_probs=35.4 Q ss_pred CCCHHHHHHHHHHHHHC--CCCEEEEEECCCCCHHHHHHHHHCCCCEEEECHH Q ss_conf 45424689999999740--8974899967889999999999839997545278 Q gi|254780434|r 268 PLFLKSTIALAKIRQRV--GPKIAIIGTGGISSTKDALDKIMAGANLIQLYSA 318 (362) Q Consensus 268 ~i~~~al~~i~~i~~~~--~~~i~IIg~GGI~s~~Da~e~l~aGAs~VQi~Ta 318 (362) T Consensus 198 ~LlP~i~~LRd~~~~~~~y~~~iRvGaAGGIGTP~aaaAAF~mGA~yVvTGSI 250 (418) T cd04742 198 VLLPTIIRLRDELAARYGYRRPIRVGAAGGIGTPEAAAAAFALGADFIVTGSI 250 (418) T ss_pred HHHHHHHHHHHHHHHHCCCCCCCEECCCCCCCCHHHHHHHHHCCCCEEEECCH T ss_conf 89899999999999861888884110358879879999999717744895553

HHsearch alignment for GI: 254780434 and conserved domain: cd04742