HHsearch alignment for GI: 254780436 and conserved domain: COG1729

>COG1729 Uncharacterized protein conserved in bacteria [Function unknown].
Probab=98.02  E-value=4.1e-06  Score=50.04  Aligned_cols=110  Identities=21%  Similarity=0.251  Sum_probs=87.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---HHHHHHHHH
Q ss_conf             222222111111111222121111111122--212222222222211111111222111223233388---899999999
Q gi|254780436|r  176 WYGRALVYQMRGEYEKSIEDFSQAISLYSS--ISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKK---ASFWFNGGM  250 (298)
Q Consensus       176 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~a~~~~~~a~~~~p~~---~~~~~~lg~  250 (298)
T Consensus       144 ~Y~~A~~~~ksgdy~~A~~~F~~fi~~YP~s~~~~nA~yWLGe~~y~qg~y~~Aa~~f~~~~k~~P~s~KApdallKlg~  223 (262)
T COG1729         144 LYNAALDLYKSGDYAEAEQAFQAFIKKYPNSTYTPNAYYWLGESLYAQGDYEDAAYIFARVVKDYPKSPKAPDALLKLGV  223 (262)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHH
T ss_conf             99999999983878899999999997099975560249998899986246167999999999838999988289999999


Q ss_pred             HHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             99984998999999999986179998999999999
Q gi|254780436|r  251 VYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRI  285 (298)
Q Consensus       251 ~~~~~g~~~~A~~~~~kAl~l~P~~~~a~~~la~i  285 (298)
T Consensus       224 ~~~~l~~~d~A~atl~qv~k~YP~t~aA~~Ak~~~  258 (262)
T COG1729         224 SLGRLGNTDEACATLQQVIKRYPGTDAAKLAKVAL  258 (262)
T ss_pred             HHHHHCCHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             99982177999999999998789977999999987