HHsearch alignment for GI: 254780436 and conserved domain: COG3063

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion].
Probab=99.31  E-value=9.4e-13  Score=86.07  Aligned_cols=156  Identities=22%  Similarity=0.289  Sum_probs=124.9

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             89999999999972985222211111111111111112110000000112222111111222211111112222222222
Q gi|254780436|r   69 PEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGTALKINPDYDVAYIGRGNIYR  148 (298)
Q Consensus        69 ~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~  148 (298)
T Consensus        35 a~arlqLal~YL~~gd~~~A~~nlekAL~~DPs~~~a~~~~A~~Yq~~Ge~~~A~e~YrkAlsl~p~~GdVLNNYG~F--  112 (250)
T COG3063          35 AKARLQLALGYLQQGDYAQAKKNLEKALEHDPSYYLAHLVRAHYYQKLGENDLADESYRKALSLAPNNGDVLNNYGAF--  112 (250)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHH--
T ss_conf             999999999999778999999889999884952088999999999990775567999999985298864055210699--


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             21111111111121111222222222222222211111111122212111111112221222222222221111111122
Q gi|254780436|r  149 DERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSAL  228 (298)
Q Consensus       149 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~  228 (298)
T Consensus       113 ---------------------------------------------------------------------LC~qg~~~eA~  123 (250)
T COG3063         113 ---------------------------------------------------------------------LCAQGRPEEAM  123 (250)
T ss_pred             ---------------------------------------------------------------------HHHCCCHHHHH
T ss_conf             ---------------------------------------------------------------------97089868999


Q ss_pred             CCCCCCCCC--CCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             211122323--3388899999999999849989999999999861799989999999999997428887
Q gi|254780436|r  229 EDFKFAINL--DPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDLSSTVNE  295 (298)
Q Consensus       229 ~~~~~a~~~--~p~~~~~~~~lg~~~~~~g~~~~A~~~~~kAl~l~P~~~~a~~~la~i~~~lg~~~~~  295 (298)
T Consensus       124 q~F~~Al~~P~Y~~~s~t~eN~G~Cal~~gq~~~A~~~l~raL~~dp~~~~~~l~~a~~~~~~~~y~~A  192 (250)
T COG3063         124 QQFERALADPAYGEPSDTLENLGLCALKAGQFDQAEEYLKRALELDPQFPPALLELARLHYKAGDYAPA  192 (250)
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCCHHH
T ss_conf             999998718887775304544578886437704479999999883757876789987988753130189