HHsearch alignment for GI: 254780436 and conserved domain: COG3071

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism].
Probab=98.90  E-value=2e-09  Score=68.03  Aligned_cols=258  Identities=11%  Similarity=-0.022  Sum_probs=159.7

Q ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCH
Q ss_conf             319999999999998199899999999999816899-8999999999997298522221111111111111111211000
Q gi|254780436|r   33 VSVILLIEGCSSLFPSMGRRVNIDSLTAVIRAHPSD-PEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRAL  111 (298)
Q Consensus        33 ~~~~~~~~~~~~~~~~~~~~~Ai~~~~~al~~~P~~-~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~  111 (298)
T Consensus       116 ~p~l~~l~aA~AA~qrgd~~~an~yL~eaae~~~~~~l~v~ltrarlll~~~d~~aA~~~v~~ll~~~pr~~~vlrLa~r  195 (400)
T COG3071         116 QPVLAYLLAAEAAQQRGDEDRANRYLAEAAELAGDDTLAVELTRARLLLNRRDYPAARENVDQLLEMTPRHPEVLRLALR  195 (400)
T ss_pred             CHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCHHHHHHHHH
T ss_conf             40899999999988630577898999998625899408899999999986788656898899998728688699999999


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             00001122221111112222111111122222---2222221111111111---12111122222222222222221111
Q gi|254780436|r  112 IRYKMGDVPMAIRDYGTALKINPDYDVAYIGR---GNIYRDERYSDLQKAF---ADFDRAIQLKTSDGRAWYGRALVYQM  185 (298)
Q Consensus       112 ~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~  185 (298)
T Consensus       196 ~y~~~g~~~~ll~~l~~L~ka~~l~~~e~~~le~~a~~glL~q~~~~~~~~gL~~~W~~~pr~lr~~p~l~~~~a~~li~  275 (400)
T COG3071         196 AYIRLGAWQALLAILPKLRKAGLLSDEEAARLEQQAWEGLLQQARDDNGSEGLKTWWKNQPRKLRNDPELVVAYAERLIR  275 (400)
T ss_pred             HHHHHCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCHHHHCCHHHHHHHHHHHHH
T ss_conf             99985118999998899987357882999999999999999987362001478999986649760583489999999997


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHH
Q ss_conf             11111222121111111122212222222222211111111222111223233388899999999999849989999999
Q gi|254780436|r  186 RGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYY  265 (298)
Q Consensus       186 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~  265 (298)
T Consensus       276 l~~~~~A~~~i~~~Lk~~~D~~----L~~~~~~l~~~d~~~l~k~~e~~l~~h~~~p~L~~tLG~L~~k~~~w~kA~~~l  351 (400)
T COG3071         276 LGDHDEAQEIIEDALKRQWDPR----LCRLIPRLRPGDPEPLIKAAEKWLKQHPEDPLLLSTLGRLALKNKLWGKASEAL  351 (400)
T ss_pred             CCCHHHHHHHHHHHHHHCCCHH----HHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             5876889999999987445856----999886518899367999999999839998149999999999841789999999


Q ss_pred             HHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999861799989999999999997428887
Q gi|254780436|r  266 KKALSVDSRYYRAKNGILRISQDLSSTVNE  295 (298)
Q Consensus       266 ~kAl~l~P~~~~a~~~la~i~~~lg~~~~~  295 (298)
T Consensus       352 eaAl~~~~s-~~~~~~la~~~~~~g~~~~A  380 (400)
T COG3071         352 EAALKLRPS-ASDYAELADALDQLGEPEEA  380 (400)
T ss_pred             HHHHHCCCC-HHHHHHHHHHHHHCCCHHHH
T ss_conf             999725897-43699999999981886889