HHsearch alignment for GI: 254780436 and conserved domain: COG3071

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism].
Probab=98.38  E-value=2.9e-07  Score=56.28  Aligned_cols=252  Identities=14%  Similarity=0.065  Sum_probs=155.0

Q ss_pred             HHHCCCHHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             66325979999899999997--2319999999999998199899999999999816899899999999999729852222
Q gi|254780436|r   12 GCGFLRSSKRRGYYSLLSVL--VVSVILLIEGCSSLFPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKAL   89 (298)
Q Consensus        12 ~~~l~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~Ai~~~~~al~~~P~~~~~~~~lg~~~~~~g~~~~A~   89 (298)
T Consensus       128 A~qrgd~~~an~yL~eaae~~~~~~l~v~ltrarlll~~~d~~aA~~~v~~ll~~~pr~~~vlrLa~r~y~~~g~~~~ll  207 (400)
T COG3071         128 AQQRGDEDRANRYLAEAAELAGDDTLAVELTRARLLLNRRDYPAARENVDQLLEMTPRHPEVLRLALRAYIRLGAWQALL  207 (400)
T ss_pred             HHHCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCHHHHH
T ss_conf             88630577898999998625899408899999999986788656898899998728688699999999999851189999


Q ss_pred             CCCCCCCCCCCCCCCC---CCC---CCHHHCCCCCCCCCCC---CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             1111111111111111---211---0000000112222111---111222211111112222222222211111111111
Q gi|254780436|r   90 LDFQSALDLNPRYYKV---YAN---RALIRYKMGDVPMAIR---DYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFA  160 (298)
Q Consensus        90 ~~~~~al~~~~~~~~~---~~~---~~~~~~~~~~~~~a~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (298)
T Consensus       208 ~~l~~L~ka~~l~~~e~~~le~~a~~glL~q~~-~~~~~~gL~~~W~~~pr~lr~~p~l~~~--~a~~li~l~~~~~A~~  284 (400)
T COG3071         208 AILPKLRKAGLLSDEEAARLEQQAWEGLLQQAR-DDNGSEGLKTWWKNQPRKLRNDPELVVA--YAERLIRLGDHDEAQE  284 (400)
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHH-CCCCCHHHHHHHHHCCHHHHCCHHHHHH--HHHHHHHCCCHHHHHH
T ss_conf             988999873578829999999999999999873-6200147899998664976058348999--9999997587688999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             21111222222222222222211111111122212111111112221222222222221111111122211122323338
Q gi|254780436|r  161 DFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPK  240 (298)
Q Consensus       161 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~a~~~~p~  240 (298)
T Consensus       285 ~i~~~Lk~~~D~~L~---~~~~~l~~~d~~~l~k~~e~~l~~h~-~~p~L~~tLG~L~~k~~~w~kA~~~leaAl~~~~s  360 (400)
T COG3071         285 IIEDALKRQWDPRLC---RLIPRLRPGDPEPLIKAAEKWLKQHP-EDPLLLSTLGRLALKNKLWGKASEALEAALKLRPS  360 (400)
T ss_pred             HHHHHHHHCCCHHHH---HHHHHCCCCCCHHHHHHHHHHHHHCC-CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             999998744585699---98865188993679999999998399-98149999999999841789999999999725897


Q ss_pred             CHHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
Q ss_conf             8899999999999849989999999999861
Q gi|254780436|r  241 KASFWFNGGMVYEMQGSYANAVKYYKKALSV  271 (298)
Q Consensus       241 ~~~~~~~lg~~~~~~g~~~~A~~~~~kAl~l  271 (298)
T Consensus       361 -~~~~~~la~~~~~~g~~~~A~~~r~e~L~~  390 (400)
T COG3071         361 -ASDYAELADALDQLGEPEEAEQVRREALLL  390 (400)
T ss_pred             -HHHHHHHHHHHHHCCCHHHHHHHHHHHHHH
T ss_conf             -436999999999818868899999999987