HHsearch alignment for GI: 254780436 and conserved domain: COG4700

>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown].
Probab=95.82  E-value=0.03  Score=29.05  Aligned_cols=159  Identities=16%  Similarity=0.148  Sum_probs=80.8

Q ss_pred             HCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCHHHCCCCCCCCCCCC
Q ss_conf             819989999999999981689989999999999972985222211111111-1111111121100000001122221111
Q gi|254780436|r   47 PSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALD-LNPRYYKVYANRALIRYKMGDVPMAIRD  125 (298)
Q Consensus        47 ~~~~~~~Ai~~~~~al~~~P~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~-~~~~~~~~~~~~~~~~~~~~~~~~a~~~  125 (298)
T Consensus        68 q~ldP~R~~Rea~~~~~~ApTvqn-r~rLa~al~elGr~~EA~~hy~qalsG~fA~d~a~lLglA~Aqfa~~~~A~a~~t  146 (251)
T COG4700          68 QKLDPERHLREATEELAIAPTVQN-RYRLANALAELGRYHEAVPHYQQALSGIFAHDAAMLLGLAQAQFAIQEFAAAQQT  146 (251)
T ss_pred             HHCCHHHHHHHHHHHHHHCHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCHHHHHHH
T ss_conf             862915899999988764613788-9999999998410566688999985465679889998889888861658888889


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11222211111112222222222211111111111211112222222222222222111111111222121111111122
Q gi|254780436|r  126 YGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSS  205 (298)
Q Consensus       126 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  205 (298)
T Consensus       147 Le~l~e~------------------------------------~p---------------------------------a~  157 (251)
T COG4700         147 LEDLMEY------------------------------------NP---------------------------------AF  157 (251)
T ss_pred             HHHHHHC------------------------------------CC---------------------------------CC
T ss_conf             9998605------------------------------------97---------------------------------65


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHH----HHHHHHCCCCH
Q ss_conf             212222222222211111111222111223233388899999999999849989999999----99986179998
Q gi|254780436|r  206 ISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYY----KKALSVDSRYY  276 (298)
Q Consensus       206 ~~~~~~~~~~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~----~kAl~l~P~~~  276 (298)
T Consensus       158 r~pd~~Ll~aR~laa~g~~a~Aesafe~a~~~ypg-~~ar~~Y~e~La~qgr~~ea~aq~~~v~d~~~r~~~H~r  231 (251)
T COG4700         158 RSPDGHLLFARTLAAQGKYADAESAFEVAISYYPG-PQARIYYAEMLAKQGRLREANAQYVAVVDTAKRSRPHYR  231 (251)
T ss_pred             CCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHHCCC-HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCHHHH
T ss_conf             89972589999998458805589999999985887-778989999999712216788879999999976046678