HHsearch alignment for GI: 254780436 and conserved domain: KOG0530

>KOG0530 consensus.
Probab=93.65  E-value=0.035  Score=28.70  Aligned_cols=101  Identities=19%  Similarity=0.214  Sum_probs=79.0

Q ss_pred             HHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCC-CCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCC-CCC
Q ss_conf             98199899999999999816899899999999999729-8522221111111111111111211000000011222-211
Q gi|254780436|r   46 FPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNG-DFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVP-MAI  123 (298)
Q Consensus        46 ~~~~~~~~Ai~~~~~al~~~P~~~~~~~~lg~~~~~~g-~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~-~a~  123 (298)
T Consensus        54 ~~~E~S~RAl~LT~d~i~lNpAnYTVW~yRr~iL~~l~~dL~~El~~l~eI~e~npKNYQvWHHRr~ive~l~d~s~rEL  133 (318)
T KOG0530          54 AKNEKSPRALQLTEDAIRLNPANYTVWQYRRVILRHLMSDLNKELEYLDEIIEDNPKNYQVWHHRRVIVELLGDPSFREL  133 (318)
T ss_pred             HCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCHH
T ss_conf             62656878999899999728542148999999999868889999999999987386521477999999998069411037


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             11112222111111122222222
Q gi|254780436|r  124 RDYGTALKINPDYDVAYIGRGNI  146 (298)
Q Consensus       124 ~~~~~~~~~~~~~~~~~~~~~~~  146 (298)
T Consensus       134 ef~~~~l~~DaKNYHaWshRqW~  156 (318)
T KOG0530         134 EFTKLMLDDDAKNYHAWSHRQWV  156 (318)
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHH
T ss_conf             89999971111100266899999