HHsearch alignment for GI: 254780436 and conserved domain: KOG0545

>KOG0545 consensus.
Probab=97.35  E-value=7.5e-05  Score=43.16  Aligned_cols=104  Identities=14%  Similarity=0.091  Sum_probs=76.6

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC-------CCCC----------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             222222111111111222121111111-------1222----------12222222222211111111222111223233
Q gi|254780436|r  176 WYGRALVYQMRGEYEKSIEDFSQAISL-------YSSI----------SPDYYNGRGISYLATKNYDSALEDFKFAINLD  238 (298)
Q Consensus       176 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~----------~~~~~~~~~~~~~~~~~~~~a~~~~~~a~~~~  238 (298)
T Consensus       181 l~q~GN~lfk~~~ykEA~~~YreAi~~l~~L~lkEkP~e~eW~eLdk~~tpLllNy~QC~L~~~e~yevleh~seiL~~~  260 (329)
T KOG0545         181 LHQEGNRLFKLGRYKEASSKYREAIICLRNLQLKEKPGEPEWLELDKMITPLLLNYCQCLLKKEEYYEVLEHCSEILRHH  260 (329)
T ss_pred             HHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             98750146662217789999999999999887404899818999987633778867778744878999999889998508


Q ss_pred             CCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             38889999999999984998999999999986179998999
Q gi|254780436|r  239 PKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAK  279 (298)
Q Consensus       239 p~~~~~~~~lg~~~~~~g~~~~A~~~~~kAl~l~P~~~~a~  279 (298)
T Consensus       261 ~~nvKA~frRakAhaa~Wn~~eA~~D~~~vL~ldpslasvV  301 (329)
T KOG0545         261 PGNVKAYFRRAKAHAAVWNEAEAKADLQKVLELDPSLASVV  301 (329)
T ss_pred             CCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCHHHHHHH
T ss_conf             85089999987787753688888889999986195667899