HHsearch alignment for GI: 254780436 and conserved domain: KOG0546

>KOG0546 consensus.
Probab=95.68  E-value=0.033  Score=28.81  Aligned_cols=83  Identities=16%  Similarity=0.116  Sum_probs=70.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHH
Q ss_conf             22222222221111111122211122323338889999999999984998999999999986179998999999999999
Q gi|254780436|r  209 DYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQD  288 (298)
Q Consensus       209 ~~~~~~~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~kAl~l~P~~~~a~~~la~i~~~  288 (298)
T Consensus       276 ~~~~n~~~~~lk~~~~~~a~~~~~~~~~~~~s~tka~~Rr~~~~~~~~~~~~a~~~~~~a~~~~p~d~~i~~~~~~~~~~  355 (372)
T KOG0546         276 SIRRNLAAVGLKVKGRGGARFRTNEALRDERSKTKAHYRRGQAYKLLKNYDEALEDLKKAKQKAPNDKAIEEELENVRQK  355 (372)
T ss_pred             CCCCCHHHHCCCCCCCCCCEECCCCCCCCCHHHCCHHHHHHHHHHHHHCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHH
T ss_conf             00023677512136777623216400236811182888877688764345666778887542285449999999986657


Q ss_pred             HHH
Q ss_conf             742
Q gi|254780436|r  289 LSS  291 (298)
Q Consensus       289 lg~  291 (298)
T Consensus       356 ~~~  358 (372)
T KOG0546         356 KKQ  358 (372)
T ss_pred             HHH
T ss_conf             887