HHsearch alignment for GI: 254780436 and conserved domain: KOG0550

>KOG0550 consensus.
Probab=99.46  E-value=1.9e-14  Score=95.21  Aligned_cols=269  Identities=16%  Similarity=0.152  Sum_probs=207.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCC-
Q ss_conf             7999989999999723199999-99999998199899999999999816899899999999999729852222111111-
Q gi|254780436|r   18 SSKRRGYYSLLSVLVVSVILLI-EGCSSLFPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSA-   95 (298)
Q Consensus        18 ~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~Ai~~~~~al~~~P~~~~~~~~lg~~~~~~g~~~~A~~~~~~a-   95 (298)
T Consensus        65 Y~nal~~yt~Ai~~~pd~a~yy~nRAa~~m~~~~~~~a~~dar~~~r~kd~~~k~~~r~~~c~~a~~~~i~A~~~~~~~~  144 (486)
T KOG0550          65 YGNALKNYTFAIDMCPDNASYYSNRAATLMMLGRFEEALGDARQSVRLKDGFSKGQLREGQCHLALSDLIEAEEKLKSKQ  144 (486)
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHCHHHHHHHHHHHHHHCCCCHHHHEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             88899888999985840036544168899987767524211665300578741012452244555678898998862101


Q ss_pred             --------------CCC---CCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             --------------111---111111121100000001122221111112222111111122222222222111111111
Q gi|254780436|r   96 --------------LDL---NPRYYKVYANRALIRYKMGDVPMAIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKA  158 (298)
Q Consensus        96 --------------l~~---~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  158 (298)
T Consensus       145 ~~~~anal~~~~~~~~s~s~~pac~~a~~lka~cl~~~~~~~~a~~ea~~ilkld~~n~~al~vrg~~~yy--~~~~~ka  222 (486)
T KOG0550         145 AYKAANALPTLEKLAPSHSREPACFKAKLLKAECLAFLGDYDEAQSEAIDILKLDATNAEALYVRGLCLYY--NDNADKA  222 (486)
T ss_pred             HHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCHHHHHHHCCCCCCC--CCCHHHH
T ss_conf             66776531222002423467732567887410565430343167788888875163016788861533102--3206888


Q ss_pred             CCCCCCCCCCCCCCCCC------------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---CCCCCCCCCCCCCCCC
Q ss_conf             11211112222222222------------22222211111111122212111111112221---2222222222211111
Q gi|254780436|r  159 FADFDRAIQLKTSDGRA------------WYGRALVYQMRGEYEKSIEDFSQAISLYSSIS---PDYYNGRGISYLATKN  223 (298)
Q Consensus       159 ~~~~~~~~~~~~~~~~~------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~  223 (298)
T Consensus       223 ~~hf~qal~ldpdh~~sk~~~~~~k~le~~k~~gN~~fk~G~y~~A~E~Yteal~idP~n~~~naklY~nra~v~~rLgr  302 (486)
T KOG0550         223 INHFQQALRLDPDHQKSKSASMMPKKLEVKKERGNDAFKNGNYRKAYECYTEALNIDPSNKKTNAKLYGNRALVNIRLGR  302 (486)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCC
T ss_conf             88876520268025667767640789998875056676344246789988776337932222468999876766420677


Q ss_pred             CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHH
Q ss_conf             111222111223233388899999999999849989999999999861799989999999999997
Q gi|254780436|r  224 YDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDL  289 (298)
Q Consensus       224 ~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~kAl~l~P~~~~a~~~la~i~~~l  289 (298)
T Consensus       303 l~eaisdc~~Al~iD~syikall~ra~c~l~le~~e~AV~d~~~a~q~~~s-~e~r~~l~~A~~aL  367 (486)
T KOG0550         303 LREAISDCNEALKIDSSYIKALLRRANCHLALEKWEEAVEDYEKAMQLEKD-CEIRRTLREAQLAL  367 (486)
T ss_pred             CHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-CCHHHHHHHHHHHH
T ss_conf             165665446666347988899999889888998999999999999863056-10678999999999