HHsearch alignment for GI: 254780436 and conserved domain: KOG0890

>KOG0890 consensus.
Probab=90.80  E-value=0.26  Score=23.96  Aligned_cols=56  Identities=9%  Similarity=0.128  Sum_probs=28.1

Q ss_pred             CCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             8889999999999984998999999999986179998999999999999742888743
Q gi|254780436|r  240 KKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDLSSTVNEVN  297 (298)
Q Consensus       240 ~~~~~~~~lg~~~~~~g~~~~A~~~~~kAl~l~P~~~~a~~~la~i~~~lg~~~~~~n  297 (298)
T Consensus      1668 ~~ge~wLqsAriaR~aG~~q~A~nall~A~e~r--~~~i~~E~AK~lW~~gd~~~Al~ 1723 (2382)
T KOG0890        1668 RLGECWLQSARIARLAGHLQRAQNALLNAKESR--LPEIVLERAKLLWQTGDELNALS 1723 (2382)
T ss_pred             HHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCC--CCHHHHHHHHHHHHHCCHHHHHH
T ss_conf             268999999999986233899999987644315--41679999999986230887999