HHsearch alignment for GI: 254780436 and conserved domain: KOG1070

>KOG1070 consensus.
Probab=96.51  E-value=0.0076  Score=32.27  Aligned_cols=197  Identities=13%  Similarity=0.088  Sum_probs=89.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCC-CCC----CCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             52222111111111111111121100000001122221111112222111-111----1222222222221111111111
Q gi|254780436|r   85 FEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGTALKINP-DYD----VAYIGRGNIYRDERYSDLQKAF  159 (298)
Q Consensus        85 ~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~-~~~----~~~~~~~~~~~~~~~~~~~~~~  159 (298)
T Consensus      1440 ~pesaeDferlvrssPNSSi~WI~YMaf~LelsEiekAR~iaerAL~tIN~REeeEKLNiWiA~--lNlEn~yG~eesl~ 1517 (1710)
T KOG1070        1440 APESAEDFERLVRSSPNSSILWIRYMAFHLELSEIEKARKIAERALKTINFREEEEKLNIWIAY--LNLENAYGTEESLK 1517 (1710)
T ss_pred             CCCCHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHH--HHHHHHHCCHHHHH
T ss_conf             7767788999986099840289999998850245677899999986117864167777789999--86787527689999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             12111122222222222222221111111112221211111111222122222222222111111112221112232333
Q gi|254780436|r  160 ADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDP  239 (298)
Q Consensus       160 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~a~~~~p  239 (298)
T Consensus      1518 kVFeRAcqycd-~~~V~~~L~~iy~k~ek~~~A~ell~~m~KKF~-q~~~vW~~y~~fLl~~ne~~aa~~lL~rAL~~lP 1595 (1710)
T KOG1070        1518 KVFERACQYCD-AYTVHLKLLGIYEKSEKNDEADELLRLMLKKFG-QTRKVWIMYADFLLRQNEAEAARELLKRALKSLP 1595 (1710)
T ss_pred             HHHHHHHHHCC-HHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHC-CHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCC
T ss_conf             99999987433-688999988799876231048999999999865-3256899999998514478899999999986465


Q ss_pred             C--CHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             8--889999999999984998999999999986179998999999999
Q gi|254780436|r  240 K--KASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRI  285 (298)
Q Consensus       240 ~--~~~~~~~lg~~~~~~g~~~~A~~~~~kAl~l~P~~~~a~~~la~i  285 (298)
T Consensus      1596 k~eHv~~IskfAqLEFk~GDaeRGRtlfEgll~ayPKRtDlW~VYid~ 1643 (1710)
T KOG1070        1596 KQEHVEFISKFAQLEFKYGDAERGRTLFEGLLSAYPKRTDLWSVYIDM 1643 (1710)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             023688999999987651884356789887776385430279999998