HHsearch alignment for GI: 254780436 and conserved domain: KOG1130

>KOG1130 consensus.
Probab=98.97  E-value=2.5e-10  Score=72.88  Aligned_cols=262  Identities=20%  Similarity=0.248  Sum_probs=171.7

Q ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHH----HHHHHHHHHHHCCCCCCCCCCCCCCCCC------CCCCCC
Q ss_conf             999999999999819989999999999981689989----9999999999729852222111111111------111111
Q gi|254780436|r   35 VILLIEGCSSLFPSMGRRVNIDSLTAVIRAHPSDPE----GYNVRGVVYGMNGDFEKALLDFQSALDL------NPRYYK  104 (298)
Q Consensus        35 ~~~~~~~~~~~~~~~~~~~Ai~~~~~al~~~P~~~~----~~~~lg~~~~~~g~~~~A~~~~~~al~~------~~~~~~  104 (298)
T Consensus        17 CleLalEGERLck~gdcraGv~ff~aA~qvGTeDl~tLSAIYsQLGNAyfyL~DY~kAl~yH~hDltlar~lgdklGEAK   96 (639)
T KOG1130          17 CLELALEGERLCKMGDCRAGVDFFKAALQVGTEDLSTLSAIYSQLGNAYFYLKDYEKALKYHTHDLTLARLLGDKLGEAK   96 (639)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCCCC
T ss_conf             99999878788751462456899999998361278899999997411444676399997642235779987444201220


Q ss_pred             CCCCCCHHHCCCCCCCCCCCCCCCCCCCCCC------CCCCCCCCCCCCCCCCCCC------------------CCCCCC
Q ss_conf             1211000000011222211111122221111------1112222222222211111------------------111111
Q gi|254780436|r  105 VYANRALIRYKMGDVPMAIRDYGTALKINPD------YDVAYIGRGNIYRDERYSD------------------LQKAFA  160 (298)
Q Consensus       105 ~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~------------------~~~~~~  160 (298)
T Consensus        97 ssgNLGNtlKv~G~fdeA~~cc~rhLd~areLgDrv~e~RAlYNlgnvYhakGk~~g~~~pee~g~f~~ev~~al~~Av~  176 (639)
T KOG1130          97 SSGNLGNTLKVKGAFDEALTCCFRHLDFARELGDRVLESRALYNLGNVYHAKGKCTGLEAPEEKGAFNAEVTSALENAVK  176 (639)
T ss_pred             CCCCCCCHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCHHHHHHHHHHHH
T ss_conf             04552014563023206889999886799997477766577741111122126415888814306554788999999999


Q ss_pred             CCCCCCCC------CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             21111222------2222222222222111111111222121111111122-----212222222222211111111222
Q gi|254780436|r  161 DFDRAIQL------KTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSS-----ISPDYYNGRGISYLATKNYDSALE  229 (298)
Q Consensus       161 ~~~~~~~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~a~~  229 (298)
T Consensus       177 fy~eNL~l~~~lgDr~aqGRa~GnLGNTyYlLGdf~~ai~~H~~RL~ia~efGDrAaeRRA~sNlgN~hiflg~fe~A~e  256 (639)
T KOG1130         177 FYMENLELSEKLGDRLAQGRAYGNLGNTYYLLGDFDQAIHFHKLRLEIAQEFGDRAAERRAHSNLGNCHIFLGNFELAIE  256 (639)
T ss_pred             HHHHHHHHHHHHHHHHHHCCHHCCCCCEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHCCCHHHHH
T ss_conf             99998999987446776331102457635650457999999999999999863188887764043103555304276999


Q ss_pred             CCCCCCCC----C--CCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             11122323----3--38889999999999984998999999999986179998999999999999742888743
Q gi|254780436|r  230 DFKFAINL----D--PKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDLSSTVNEVN  297 (298)
Q Consensus       230 ~~~~a~~~----~--p~~~~~~~~lg~~~~~~g~~~~A~~~~~kAl~l~P~~~~a~~~la~i~~~lg~~~~~~n  297 (298)
T Consensus       257 hYK~tl~LAielg~r~vEAQscYSLgNtytll~e~~kAI~Yh~rHLaIAqeL-~DriGe~RacwSLgna~~alg  329 (639)
T KOG1130         257 HYKLTLNLAIELGNRTVEAQSCYSLGNTYTLLKEVQKAITYHQRHLAIAQEL-EDRIGELRACWSLGNAFNALG  329 (639)
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999999963136888989876448999999999999999999999998-876414899999878887642