HHsearch alignment for GI: 254780436 and conserved domain: KOG1174

>KOG1174 consensus.
Probab=99.24  E-value=8e-13  Score=86.44  Aligned_cols=244  Identities=16%  Similarity=0.091  Sum_probs=156.1

Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCC
Q ss_conf             99899999999999816899899999999999729852222111111111111111121100000001122221111112
Q gi|254780436|r   49 MGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGT  128 (298)
Q Consensus        49 ~~~~~Ai~~~~~al~~~P~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~  128 (298)
T Consensus       212 hs~a~~t~l~le~~~~lr~NvhLl~~lak~~~~~Gdn~~a~~~Fe~~~~~dpy~i~~MD~Ya~LL~~eg~~e~~~~L~~~  291 (564)
T KOG1174         212 HSDASQTFLMLHDNTTLRCNEHLMMALGKCLYYNGDYFQAEDIFSSTLCANPDNVEAMDLYAVLLGQEGGCEQDSALMDY  291 (564)
T ss_pred             CCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCHHHHHHHHHH
T ss_conf             30366588878765406760889988755653416756899999887507815555689999999860487678999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22211111112222222222211111111111211112222222222222222111111111222121111111122212
Q gi|254780436|r  129 ALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISP  208 (298)
Q Consensus       129 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  208 (298)
T Consensus       292 Lf~~~~~ta~~wfV~~~~l~--~~K~~~rAL~~~eK~I~~~~r~~~alilKG~lL~~~~R~~~A~IaFR~Aq~Lap~-rL  368 (564)
T KOG1174         292 LFAKVKYTASHWFVHAQLLY--DEKKFERALNFVEKCIDSEPRNHEALILKGRLLIALERHTQAVIAFRTAQMLAPY-RL  368 (564)
T ss_pred             HHHHCCCCCCCEEEEEEHHH--HHHHHHHHHHHHHHHHHCCCCCCHHHHHCCHHHHHCCCHHHHHHHHHHHHHCCHH-HH
T ss_conf             98522023240234310145--7766899999998876158553367886139988545628899999998742514-57


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHH--HHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
Q ss_conf             22222222221111111122211122323338889999999--9999849989999999999861799989999999999
Q gi|254780436|r  209 DYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGG--MVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRIS  286 (298)
Q Consensus       209 ~~~~~~~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg--~~~~~~g~~~~A~~~~~kAl~l~P~~~~a~~~la~i~  286 (298)
T Consensus       369 ~~Y~GL~hsYLA~~~~kEA~~~An~~~~~~~~sA~~LtL~g~~V~~~dp~~rEKAKkf~ek~L~~~P~Y~~AV~~~AEL~  448 (564)
T KOG1174         369 EIYRGLFHSYLAQKRFKEANALANWTIRLFQNSARSLTLFGTLVLFPDPRMREKAKKFAEKSLKINPIYTPAVNLIAELC  448 (564)
T ss_pred             HHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHEEECCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHH
T ss_conf             89988999999614089999999999997653144676630001156850679999999842035886089999999999


Q ss_pred             HHHHHHHHH
Q ss_conf             997428887
Q gi|254780436|r  287 QDLSSTVNE  295 (298)
Q Consensus       287 ~~lg~~~~~  295 (298)
T Consensus       449 ~~Eg~~~D~  457 (564)
T KOG1174         449 QVEGPTKDI  457 (564)
T ss_pred             HHHCCCCCH
T ss_conf             862765418