HHsearch alignment for GI: 254780436 and conserved domain: KOG1941

>KOG1941 consensus.
Probab=91.67  E-value=0.069  Score=27.10  Aligned_cols=62  Identities=19%  Similarity=0.019  Sum_probs=28.7

Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCC------CCCCCCHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             99999999999729852222111111111111111------121100000001122221111112222
Q gi|254780436|r   70 EGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYK------VYANRALIRYKMGDVPMAIRDYGTALK  131 (298)
Q Consensus        70 ~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~------~~~~~~~~~~~~~~~~~a~~~~~~~~~  131 (298)
T Consensus       123 q~~l~~~~Ahlgls~fq~~Lesfe~A~~~A~~~~D~~LElqvcv~Lgslf~~l~D~~Kal~f~~kA~~  190 (518)
T KOG1941         123 QVSLSMGNAHLGLSVFQKALESFEKALRYAHNNDDAMLELQVCVSLGSLFAQLKDYEKALFFPCKAAE  190 (518)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             35657777751378899999999999987650698403541353388999998744677761476999