HHsearch alignment for GI: 254780436 and conserved domain: KOG2053

>KOG2053 consensus.
Probab=96.08  E-value=0.016  Score=30.55  Aligned_cols=81  Identities=15%  Similarity=0.088  Sum_probs=54.6

Q ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHC
Q ss_conf             99999999999981998999999999998168998999999999997298522221111111111111111211000000
Q gi|254780436|r   35 VILLIEGCSSLFPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRY  114 (298)
Q Consensus        35 ~~~~~~~~~~~~~~~~~~~Ai~~~~~al~~~P~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~  114 (298)
T Consensus        43 ~~a~vLkaLsl~r~gk~~ea~~~Le~~~~~~~~D~~tLq~l~~~y~d~~~~d~~~~~Ye~~~~~~P~-eell~~lFmayv  121 (932)
T KOG2053          43 LYAKVLKALSLFRLGKGDEALKLLEALYGLKGTDDLTLQFLQNVYRDLGKLDEAVHLYERANQKYPS-EELLYHLFMAYV  121 (932)
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC-HHHHHHHHHHHH
T ss_conf             7999999999998158646788875130479985689999999999874256899999998710884-889999999999


Q ss_pred             CC
Q ss_conf             01
Q gi|254780436|r  115 KM  116 (298)
Q Consensus       115 ~~  116 (298)
T Consensus       122 R~  123 (932)
T KOG2053         122 RE  123 (932)
T ss_pred             HH
T ss_conf             98