HHsearch alignment for GI: 254780436 and conserved domain: KOG2796

>KOG2796 consensus.
Probab=97.35  E-value=0.0018  Score=35.65  Aligned_cols=117  Identities=15%  Similarity=0.134  Sum_probs=78.5

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             2222222222221111111112221211111111-----22212222222222211111111222111223233388899
Q gi|254780436|r  170 TSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLY-----SSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASF  244 (298)
Q Consensus       170 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~  244 (298)
T Consensus       209 e~~p~L~s~Lgr~~MQ~GD~k~a~~yf~~vek~~~kL~~~q~~~~V~~n~a~i~lg~nn~a~a~r~~~~i~~~D~~~~~a  288 (366)
T KOG2796         209 EQEPQLLSGLGRISMQIGDIKTAEKYFQDVEKVTQKLDGLQGKIMVLMNSAFLHLGQNNFAEAHRFFTEILRMDPRNAVA  288 (366)
T ss_pred             CCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHEEECCCCHHHHHHHHHHCCCCCCCCHHH
T ss_conf             30679999987888860438889989999998761432340467887634420221333599999885042248987022


Q ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHH---HHHHHHHHH
Q ss_conf             999999999849989999999999861799989---999999999
Q gi|254780436|r  245 WFNGGMVYEMQGSYANAVKYYKKALSVDSRYYR---AKNGILRIS  286 (298)
Q Consensus       245 ~~~lg~~~~~~g~~~~A~~~~~kAl~l~P~~~~---a~~~la~i~  286 (298)
T Consensus       289 ~NnKALcllYlg~l~DAiK~~e~~~~~~P~~~l~es~~~nL~tmy  333 (366)
T KOG2796         289 NNNKALCLLYLGKLKDALKQLEAMVQQDPRHYLHESVLFNLTTMY  333 (366)
T ss_pred             HCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHH
T ss_conf             051999999987788999999987611886210145888789899