HHsearch alignment for GI: 254780436 and conserved domain: KOG3785

>KOG3785 consensus.
Probab=98.27  E-value=7.4e-08  Score=59.50  Aligned_cols=54  Identities=11%  Similarity=-0.047  Sum_probs=26.4

Q ss_pred             HHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             999998199899999999999816899899999999999729852222111111
Q gi|254780436|r   42 CSSLFPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSA   95 (298)
Q Consensus        42 ~~~~~~~~~~~~Ai~~~~~al~~~P~~~~~~~~lg~~~~~~g~~~~A~~~~~~a   95 (298)
T Consensus        64 a~C~fhLgdY~~Al~~Y~~~~~~~~~~~el~vnLAcc~FyLg~Y~eA~~~~~ka  117 (557)
T KOG3785          64 AHCYFHLGDYEEALNVYTFLMNKDDAPAELGVNLACCKFYLGQYIEAKSIAEKA  117 (557)
T ss_pred             HHHHHHHCCHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             998875213999999999885367997010252899999999899999998618