HHsearch alignment for GI: 254780436 and conserved domain: KOG3824

>KOG3824 consensus.
Probab=97.44  E-value=0.00024  Score=40.45  Aligned_cols=80  Identities=16%  Similarity=0.175  Sum_probs=70.8

Q ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             19999999999998199899999999999816899899999999999729852222111111111111111121100000
Q gi|254780436|r   34 SVILLIEGCSSLFPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIR  113 (298)
Q Consensus        34 ~~~~~~~~~~~~~~~~~~~~Ai~~~~~al~~~P~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~  113 (298)
T Consensus       115 EA~~Al~~A~~~~~~Gk~ekA~~lfeHAlalaP~~p~~L~e~G~f~E~~~~iv~ADq~Y~~ALtisP~nseALvnR~RT~  194 (472)
T KOG3824         115 EAILALKAAGRSRKDGKLEKAMTLFEHALALAPTNPQILIEMGQFREMHNEIVEADQCYVKALTISPGNSEALVNRARTT  194 (472)
T ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHEEEEECCCCHHHHHHHHCCC
T ss_conf             99999999889886434688999999998308997799999768888514467665564202321798558775031154