HHsearch alignment for GI: 254780436 and conserved domain: KOG3824

>KOG3824 consensus.
Probab=97.25  E-value=0.00014  Score=41.77  Aligned_cols=65  Identities=28%  Similarity=0.350  Sum_probs=38.6

Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             99729852222111111111111111121100000001122221111112222111111122222
Q gi|254780436|r   79 YGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGTALKINPDYDVAYIGR  143 (298)
Q Consensus        79 ~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~  143 (298)
T Consensus       126 ~~~~Gk~ekA~~lfeHAlalaP~~p~~L~e~G~f~E~~~~iv~ADq~Y~~ALtisP~nseALvnR  190 (472)
T KOG3824         126 SRKDGKLEKAMTLFEHALALAPTNPQILIEMGQFREMHNEIVEADQCYVKALTISPGNSEALVNR  190 (472)
T ss_pred             HHHCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHEEEEECCCCHHHHHHH
T ss_conf             88643468899999999830899779999976888851446766556420232179855877503