HHsearch alignment for GI: 254780436 and conserved domain: KOG4234

>KOG4234 consensus.
Probab=98.59  E-value=1.6e-08  Score=63.17  Aligned_cols=107  Identities=26%  Similarity=0.394  Sum_probs=53.3

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             22111111111222121111111122212----22222222221111111122211122323338889999999999984
Q gi|254780436|r  180 ALVYQMRGEYEKSIEDFSQAISLYSSISP----DYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQ  255 (298)
Q Consensus       180 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~  255 (298)
T Consensus       102 GN~~F~ngdyeeA~skY~~Ale~cp~~~~e~rsIly~Nraaa~iKl~k~e~aI~dcsKaiel~pty~kAl~RRAeayek~  181 (271)
T KOG4234         102 GNELFKNGDYEEANSKYQEALESCPSTSTEERSILYSNRAAALIKLRKWESAIEDCSKAIELNPTYEKALERRAEAYEKM  181 (271)
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             77765134077899999999986866308889999720588998756689899998765750840679999999998855


Q ss_pred             CCHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
Q ss_conf             9989999999999861799989999999999
Q gi|254780436|r  256 GSYANAVKYYKKALSVDSRYYRAKNGILRIS  286 (298)
Q Consensus       256 g~~~~A~~~~~kAl~l~P~~~~a~~~la~i~  286 (298)
T Consensus       182 ek~eealeDyKki~E~dPs~~ear~~i~rl~  212 (271)
T KOG4234         182 EKYEEALEDYKKILESDPSRREAREAIARLP  212 (271)
T ss_pred             HHHHHHHHHHHHHHHHCCCHHHHHHHHHHCC
T ss_conf             5178889999999871820689999998527