HHsearch alignment for GI: 254780436 and conserved domain: PRK02603

>PRK02603 photosystem I assembly protein Ycf3; Provisional.
Probab=99.51  E-value=1.5e-14  Score=95.86  Aligned_cols=76  Identities=24%  Similarity=0.310  Sum_probs=53.8

Q ss_pred             HHHHCCCHHHHHHHHHHHHHHCCC--C-HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCC
Q ss_conf             999819989999999999981689--9-899999999999729852222111111111111111121100000001122
Q gi|254780436|r   44 SLFPSMGRRVNIDSLTAVIRAHPS--D-PEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDV  119 (298)
Q Consensus        44 ~~~~~~~~~~Ai~~~~~al~~~P~--~-~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~  119 (298)
T Consensus        44 ~~q~~G~Y~EAle~Y~kAL~Le~dp~D~s~ilyNiGlIY~~~G~~~kAie~Y~kALeiNP~~~~AlNNlgvIY~k~G~~  122 (172)
T PRK02603         44 SAQNDGDYAEALENYEEALKLEEDPNDRSYILYNMAIIYASNGEHDKALETYHQALELNPKQPSALNNIAVIYHKRGRK  122 (172)
T ss_pred             HHHHCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             7774579999999999987277896208999977999999869988999999999986899789999999999998599