HHsearch alignment for GI: 254780436 and conserved domain: PRK10941

>PRK10941 putative transcriptional regulator; Provisional.
Probab=97.49  E-value=0.00022  Score=40.68  Aligned_cols=76  Identities=11%  Similarity=0.050  Sum_probs=67.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             2222222221111111122211122323338889999999999984998999999999986179998999999999
Q gi|254780436|r  210 YYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRI  285 (298)
Q Consensus       210 ~~~~~~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~kAl~l~P~~~~a~~~la~i  285 (298)
T Consensus       183 mL~nLK~~~~~e~~~~~AL~~~e~lL~l~Pddp~EiRDRGli~~qL~c~~~Al~DLe~fle~~P~dp~ae~ik~qi  258 (269)
T PRK10941        183 LLDTLKAALMEEKQMELALRASEALLQFNPEDPYEIRDRGLIYAQLDCEHVALSDLSYFVEQCPEDPISEMIRAQI  258 (269)
T ss_pred             HHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHH
T ss_conf             9999999998511499999999999862969979999999999984994899999999999785972899999999