HHsearch alignment for GI: 254780436 and conserved domain: PRK11906

>PRK11906 transcriptional regulator; Provisional.
Probab=93.94  E-value=0.02  Score=29.98  Aligned_cols=63  Identities=10%  Similarity=-0.011  Sum_probs=44.4

Q ss_pred             CCCCCCC---CCCCCCCCCCHHHHHHHHHHHHH---CCCH------HHHHHHHHHHHHHCCCCHHHHHHHHHHHH
Q ss_conf             1122211---12232333888999999999998---4998------99999999998617999899999999999
Q gi|254780436|r  225 DSALEDF---KFAINLDPKKASFWFNGGMVYEM---QGSY------ANAVKYYKKALSVDSRYYRAKNGILRISQ  287 (298)
Q Consensus       225 ~~a~~~~---~~a~~~~p~~~~~~~~lg~~~~~---~g~~------~~A~~~~~kAl~l~P~~~~a~~~la~i~~  287 (298)
T Consensus       275 ~rAl~if~~~~n~s~~q~~~t~~Yc~LAEChlSlAl~G~se~e~A~~kA~e~~d~a~~i~~~n~qaLgllgLIsg  349 (458)
T PRK11906        275 YRAMTIFDRLQNKSDIQTLKTECYCLLAECHMSLALHGKSELELAAQKALELLDYVSDITTVDGKILAIMGLITG  349 (458)
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCEEEHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             999999998741678875666650119999999998462278899999999999988367777678899999861