HHsearch alignment for GI: 254780436 and conserved domain: TIGR02521

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360 Proteins in this entry are designated PilF and PilW . This outer membrane protein is required both for pilus stability and for pilus functions such as adherence to human cells. Members of this family contain copies of the TPR (tetratricopeptide repeat) domain..
Probab=99.61  E-value=3.5e-15  Score=99.28  Aligned_cols=191  Identities=19%  Similarity=0.260  Sum_probs=151.2

Q ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             9999999999998199899999999999816899899999999999729--85222211111111111111112110000
Q gi|254780436|r   35 VILLIEGCSSLFPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNG--DFEKALLDFQSALDLNPRYYKVYANRALI  112 (298)
Q Consensus        35 ~~~~~~~~~~~~~~~~~~~Ai~~~~~al~~~P~~~~~~~~lg~~~~~~g--~~~~A~~~~~~al~~~~~~~~~~~~~~~~  112 (298)
T Consensus        37 a~~r~qLal~Yl~~G~~~~Ak~~l~~AL~~dp~~~~a~~~lA~~Yq~~grP~~~~A~~~f~~Al~~~p~~g~~~NNYG~F  116 (247)
T TIGR02521        37 AKIRVQLALGYLEQGDLEKAKENLDKALEHDPDDYDAYLALALYYQQLGRPELEKAEQSFRKALTLKPNNGDVLNNYGTF  116 (247)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCEECHHHHH
T ss_conf             99999999999860787899999999987376661289999999987179955789999999862489985232014577


Q ss_pred             HCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             00011--2222111111222211111112222222222211111111111211112222222222222222111111111
Q gi|254780436|r  113 RYKMG--DVPMAIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYE  190 (298)
Q Consensus       113 ~~~~~--~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  190 (298)
T Consensus       117 LC~~g~~~~~~A~~~F~~A~~~p---------------------------------------------------------  139 (247)
T TIGR02521       117 LCQQGNDKYEQAEQQFEAAIEDP---------------------------------------------------------  139 (247)
T ss_pred             HHHCCCCCHHHHHHHHHHHHHCC---------------------------------------------------------
T ss_conf             64048970689999999998668---------------------------------------------------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             22212111111112221222222222221111111122211122323338889999999999984998999999999986
Q gi|254780436|r  191 KSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALS  270 (298)
Q Consensus       191 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~kAl~  270 (298)
T Consensus       140 -----------~Y-~~~~~~~eN~G~C~~~~g~~~~A~~~l~~Al~~dp~~p~~lleLa~l~~~~g~~~~A~~~l~ry~~  207 (247)
T TIGR02521       140 -----------LY-PQPARSYENAGLCALKAGDTEKAEKYLTRALKIDPQRPESLLELAELYYERGQYAQARALLERYQQ  207 (247)
T ss_pred             -----------CC-CCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHH
T ss_conf             -----------89-733024554999998617868899999999985878885579999998750772899999999998


Q ss_pred             HC---CCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             17---9998999999999999742888
Q gi|254780436|r  271 VD---SRYYRAKNGILRISQDLSSTVN  294 (298)
Q Consensus       271 l~---P~~~~a~~~la~i~~~lg~~~~  294 (298)
T Consensus       208 ~~G~~~~~a~sL~Lg~riA~~~Gd~~~  234 (247)
T TIGR02521       208 TVGVKNQTAESLWLGIRIARALGDVAA  234 (247)
T ss_pred             HHCCCCCCHHHHHHHHHHHHHHCCHHH
T ss_conf             736788887347899999998442999