HHsearch alignment for GI: 254780436 and conserved domain: TIGR02521

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360 Proteins in this entry are designated PilF and PilW . This outer membrane protein is required both for pilus stability and for pilus functions such as adherence to human cells. Members of this family contain copies of the TPR (tetratricopeptide repeat) domain..
Probab=99.45  E-value=1.6e-14  Score=95.63  Aligned_cols=159  Identities=22%  Similarity=0.322  Sum_probs=121.5

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             8999999999997298522221111111111111111211000000011--22221111112222111111122222222
Q gi|254780436|r   69 PEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMG--DVPMAIRDYGTALKINPDYDVAYIGRGNI  146 (298)
Q Consensus        69 ~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~--~~~~a~~~~~~~~~~~~~~~~~~~~~~~~  146 (298)
T Consensus        37 a~~r~qLal~Yl~~G~~~~Ak~~l~~AL~~dp~~~~a~~~lA~~Yq~~grP~~~~A~~~f~~Al~~~p~~g~~~NNYG~F  116 (247)
T TIGR02521        37 AKIRVQLALGYLEQGDLEKAKENLDKALEHDPDDYDAYLALALYYQQLGRPELEKAEQSFRKALTLKPNNGDVLNNYGTF  116 (247)
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCEECHHHHH
T ss_conf             99999999999860787899999999987376661289999999987179955789999999862489985232014577


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             22211111111111211112222222222222222111111--1112221211111111222122222222222111111
Q gi|254780436|r  147 YRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRG--EYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNY  224 (298)
Q Consensus       147 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  224 (298)
T Consensus       117 LC------------------------------------~~g~~~~~~A~~~F~~A--~~~p~------------------  140 (247)
T TIGR02521       117 LC------------------------------------QQGNDKYEQAEQQFEAA--IEDPL------------------  140 (247)
T ss_pred             HH------------------------------------HCCCCCHHHHHHHHHHH--HHCCC------------------
T ss_conf             64------------------------------------04897068999999999--86688------------------


Q ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             112221112232333888999999999998499899999999998617999899999999999974288874
Q gi|254780436|r  225 DSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDLSSTVNEV  296 (298)
Q Consensus       225 ~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~kAl~l~P~~~~a~~~la~i~~~lg~~~~~~  296 (298)
T Consensus       141 -------------Y~~~~~~~eN~G~C~~~~g~~~~A~~~l~~Al~~dp~~p~~lleLa~l~~~~g~~~~A~  199 (247)
T TIGR02521       141 -------------YPQPARSYENAGLCALKAGDTEKAEKYLTRALKIDPQRPESLLELAELYYERGQYAQAR  199 (247)
T ss_pred             -------------CCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHCCCHHHHH
T ss_conf             -------------97330245549999986178688999999999858788855799999987507728999