>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR014162 Members of this protein family are the product of one of seven genes regularly clustered in operons to encode the proteins of the tol-pal system, which is critical for maintaining the integrity of the bacterial outer membrane. The gene for this periplasmic protein has been designated orf2 and ybgF. All members of the seed alignment were from unique tol-pal gene regions from completed bacterial genomes. The architecture of this protein is a signal sequence, a low-complexity region usually rich in Asn and Gln, and a well-conserved region with tandem repeats that resemble the tetratricopeptide (TPR) repeat, involved in protein-protein interaction..

Probab=98.52 E-value=4e-08 Score=60.92 Aligned_cols=85 Identities=20% Similarity=0.222 Sum_probs=64.1 Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC---HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCC---HHHHHHHHHH Q ss_conf 222222211111111222111223233388---8999999999998499899999999998617999---8999999999 Q gi|254780436|r 212 NGRGISYLATKNYDSALEDFKFAINLDPKK---ASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRY---YRAKNGILRI 285 (298) Q Consensus 212 ~~~~~~~~~~~~~~~a~~~~~~a~~~~p~~---~~~~~~lg~~~~~~g~~~~A~~~~~kAl~l~P~~---~~a~~~la~i 285 (298) T Consensus 6 y~aa~~~lk~gdY~~A~~~F~~F~~~YP~S~y~pnA~YWLGe~~y~~~~~~~A~~~f~~v~~~yp~s~KaPdALLKlg~~ 85 (119) T TIGR02795 6 YDAALLVLKAGDYADAIQAFQAFLKKYPKSTYAPNAHYWLGEAYYAQGDYADAAKAFLAVVKKYPKSPKAPDALLKLGMS 85 (119) T ss_pred HHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHH T ss_conf 99999998538878999999999886879876710547999999997339999999999986458998606899999999 Q ss_pred HHHHHHHHHHH Q ss_conf 99974288874 Q gi|254780436|r 286 SQDLSSTVNEV 296 (298) Q Consensus 286 ~~~lg~~~~~~ 296 (298) T Consensus 86 ~~~~g~~~~A~ 96 (119) T TIGR02795 86 LQELGDKEKAK 96 (119) T ss_pred HHHHCCHHHHH T ss_conf 98728988999

HHsearch alignment for GI: 254780436 and conserved domain: TIGR02795