HHsearch alignment for GI: 254780436 and conserved domain: cd05804

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals. A family member from Streptomyces toyocaensis, StaR is part of a gene cluster involved in the biosynthesis of glycopeptide antibiotics (GPAs), specifically A47934. It has been speculated that StaR could be a flavoprotein hydroxylating a tyrosine sidechain. Some family members have been annotated as proteins containing tetratricopeptide (TPR) repeats, which may at least indicate mostly alpha-helical secondary structure.
Probab=97.06  E-value=0.0026  Score=34.79  Aligned_cols=59  Identities=17%  Similarity=0.077  Sum_probs=38.7

Q ss_pred             HHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCC
Q ss_conf             99999999972985222211111111111111112110000000112222111111222
Q gi|254780436|r   72 YNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGTAL  130 (298)
Q Consensus        72 ~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~  130 (298)
T Consensus       117 ~gm~AF~leE~g~~~~Ae~~a~~al~~np~d~wa~HAvAHv~~~~g~~~eG~~~l~~~~  175 (355)
T cd05804         117 LGMLAFGLEEAGQYDRAEEAARRALELNPDDAWAVHAVAHVLEMQGRFKEGIAFMESWR  175 (355)
T ss_pred             HHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf             99999999985889999999999996399993799999999998388788999998517