HHsearch alignment for GI: 254780436 and conserved domain: cd05804

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals. A family member from Streptomyces toyocaensis, StaR is part of a gene cluster involved in the biosynthesis of glycopeptide antibiotics (GPAs), specifically A47934. It has been speculated that StaR could be a flavoprotein hydroxylating a tyrosine sidechain. Some family members have been annotated as proteins containing tetratricopeptide (TPR) repeats, which may at least indicate mostly alpha-helical secondary structure.
Probab=96.41  E-value=0.0045  Score=33.54  Aligned_cols=89  Identities=18%  Similarity=0.131  Sum_probs=57.5

Q ss_pred             HHHHCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCC----CCCCCCCCCHHHCCCCCC
Q ss_conf             9998199899999999999816899899999999999729852222111111111111----111121100000001122
Q gi|254780436|r   44 SLFPSMGRRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPR----YYKVYANRALIRYKMGDV  119 (298)
Q Consensus        44 ~~~~~~~~~~Ai~~~~~al~~~P~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~----~~~~~~~~~~~~~~~~~~  119 (298)
T Consensus       123 ~leE~g~~~~Ae~~a~~al~~np~d~wa~HAvAHv~~~~g~~~eG~~~l~~~~~~w~~~~~l~~H~wWH~AL~~Le~g~~  202 (355)
T cd05804         123 GLEEAGQYDRAEEAARRALELNPDDAWAVHAVAHVLEMQGRFKEGIAFMESWRDTWDCSSMLRGHNWWHLALFYLERGDY  202 (355)
T ss_pred             HHHHCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCH
T ss_conf             99985889999999999996399993799999999998388788999998517525778858989999999998877898


Q ss_pred             CCCCCCCCCCCCC
Q ss_conf             2211111122221
Q gi|254780436|r  120 PMAIRDYGTALKI  132 (298)
Q Consensus       120 ~~a~~~~~~~~~~  132 (298)
T Consensus       203 ~~~l~iyD~~i~~  215 (355)
T cd05804         203 EAALAIYDTHIAP  215 (355)
T ss_pred             HHHHHHHHHHHCC
T ss_conf             8999998887445