HHsearch alignment for GI: 254780436 and conserved domain: pfam04733

>pfam04733 Coatomer_E Coatomer epsilon subunit. This family represents the epsilon subunit of the coatomer complex, which is involved in the regulation of intracellular protein trafficking between the endoplasmic reticulum and the Golgi complex.
Probab=98.68  E-value=6e-09  Score=65.43  Aligned_cols=244  Identities=8%  Similarity=-0.030  Sum_probs=129.2

Q ss_pred             HHHHHHHCCCHHHHHHHHHHHHHHCCCCHH-HHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCC
Q ss_conf             999999819989999999999981689989-9999999999729852222111111111111111121100000001122
Q gi|254780436|r   41 GCSSLFPSMGRRVNIDSLTAVIRAHPSDPE-GYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDV  119 (298)
Q Consensus        41 ~~~~~~~~~~~~~Ai~~~~~al~~~P~~~~-~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~~~  119 (298)
T Consensus         7 ~irn~Fy~G~Yq~~i~ea~-~~~~s~~~~~e~~~~~~Ra~IAlg~~~~vl~ei~~~~--~p~L~-av~~lA~y~~~~~~~   82 (290)
T pfam04733         7 NVRNYFYLGNYQKAINESD-VTSLSEEALVERDVYMYRSYLALGSYQIVISEIKESA--ATPLQ-AVRLLAEYLNSPSRK   82 (290)
T ss_pred             HHHHHHHHHHHHHHHHHHH-CCCCCCHHHHHHHHHHHHHHHHCCCHHHHHHHCCCCC--CCHHH-HHHHHHHHHCCCCCH
T ss_conf             8999999669999999986-3689913579999999999997377037888626789--83179-999999987484114


Q ss_pred             CCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             2211111122221--11111122222222222111111111112111122222222222222221111111112221211
Q gi|254780436|r  120 PMAIRDYGTALKI--NPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFS  197 (298)
Q Consensus       120 ~~a~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  197 (298)
T Consensus        83 ~~~~~~l~~~~~~~~~~~~~~~~~~aati~~--~~g~~e~AL~~l~~-----~~~lE~~al~VQi~L~~nR~DLA~ke~~  155 (290)
T pfam04733        83 ESILASLKEWVADSHIGSNSTLRLLAAIIFI--HEGDFDDALKHLHK-----GENLEAMALNVQILLKMHRIDLAEQQLK  155 (290)
T ss_pred             HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH--HCCCHHHHHHHHHC-----CCCHHHHHHHHHHHHHCCCHHHHHHHHH
T ss_conf             5699999999874015667899999999999--77999999999855-----8966799999999997288367999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             11111122212222222222--2111111112221112232333888999999999998499899999999998617999
Q gi|254780436|r  198 QAISLYSSISPDYYNGRGIS--YLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRY  275 (298)
Q Consensus       198 ~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~~~~A~~~~~kAl~l~P~~  275 (298)
T Consensus       156 ~~q~~~e-Ds~l~qLa~awv~l~~Ggek~q~A~yif~EL~~~~~~t~lllng~Av~~m~~~~~~eAe~~L~eAl~~d~~d  234 (290)
T pfam04733       156 KMQQIDE-DATLTQLANAWVKLAVGGEKIQDAYYIFQEFSEKYDSTPLLLNGQAVCCMCLGRYEEAESLLKEALDKDAKD  234 (290)
T ss_pred             HHHHCCC-CHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCC
T ss_conf             9884351-059999999999997264778989999999985228978999999999987478799999999998728898


Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q ss_conf             899999999999974288874
Q gi|254780436|r  276 YRAKNGILRISQDLSSTVNEV  296 (298)
Q Consensus       276 ~~a~~~la~i~~~lg~~~~~~  296 (298)
T Consensus       235 ~dtlaNliv~s~~~gK~~e~~  255 (290)
T pfam04733       235 PETLINLVVCALHLGKPAEVS  255 (290)
T ss_pred             HHHHHHHHHHHHHHCCCHHHH
T ss_conf             899999999999809987899