HHsearch alignment for GI: 254780436 and conserved domain: pfam06552

>pfam06552 TOM20_plant Plant specific mitochondrial import receptor subunit TOM20. This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins. Most mitochondrial proteins are encoded by the nuclear genome, and are synthesized in the cytosol. TOM20 is a general import receptor that binds to mitochondrial pre-sequences in the early step of protein import into the mitochondria.
Probab=95.89  E-value=0.0037  Score=33.96  Aligned_cols=57  Identities=23%  Similarity=0.271  Sum_probs=40.3

Q ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCC-----------CCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             899999999999816899899999999999729-----------852222111111111111111121
Q gi|254780436|r   51 RRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNG-----------DFEKALLDFQSALDLNPRYYKVYA  107 (298)
Q Consensus        51 ~~~Ai~~~~~al~~~P~~~~~~~~lg~~~~~~g-----------~~~~A~~~~~~al~~~~~~~~~~~  107 (298)
T Consensus        51 i~dAisKlEeAL~InP~khdalWclGNA~TS~~Fl~pD~~~A~~~F~kA~~~Fq~AvdeeP~NelYrK  118 (186)
T pfam06552        51 IQDAISKLEEALVINPKKHDALWCIGNAYTSHAFLTPDQTEAKDNFDKATQFFQQAVDEQPDNDLYRK  118 (186)
T ss_pred             HHHHHHHHHHHHCCCCCCCCHHHEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCHHHHHH
T ss_conf             99999999998713988753333005411015131787899998899999999998634986189999