HHsearch alignment for GI: 254780436 and conserved domain: smart00028

>smart00028 TPR Tetratricopeptide repeats. Repeats present in 4 or more copies in proteins. Contain a minimum of 34 amino acids each and self-associate via a "knobs and holes" mechanism.
Probab=97.88  E-value=1.5e-05  Score=47.04  Aligned_cols=34  Identities=38%  Similarity=0.627  Sum_probs=31.5

Q ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCC
Q ss_conf             8999999999998499899999999998617999
Q gi|254780436|r  242 ASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRY  275 (298)
Q Consensus       242 ~~~~~~lg~~~~~~g~~~~A~~~~~kAl~l~P~~  275 (298)
T Consensus         1 ~~~~~~lg~~y~~~~~~~~Ai~~~~~al~~~p~~   34 (34)
T smart00028        1 AEALYNLGNAYLKLGDYDEALEYYEKALELDPNN   34 (34)
T ss_pred             CHHHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCC
T ss_conf             9289998999998236999999999977359999