BLAST/PSIBLAST alignment of GI: 254780436 and GI: 307319638 at iteration 1
>gi|307319638|ref|ZP_07599064.1| TPR repeat-containing protein [Sinorhizobium meliloti AK83] Length = 307
>gi|306894760|gb|EFN25520.1| TPR repeat-containing protein [Sinorhizobium meliloti AK83] Length = 307
 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 132/266 (49%), Positives = 180/266 (67%), Gaps = 11/266 (4%)

Query: 27  LLSVLVVSVILLIEGCSSLFP--------SMGRRVNIDSLTAVIRAHPSDPEGYNVRGVV 78
           L + LV+   LLI GC +  P        + G   NI SL++VI ++PSDPEGYNVRG  
Sbjct: 40  LAAFLVLGSALLIAGCQTDKPESMFRVERAQGSEENIASLSSVIASNPSDPEGYNVRGSA 99

Query: 79  YGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGTALKINPDYDV 138
           YG  G+F +A+ DF  A+ LNPR+Y+ YANRAL++  +G+   A+ DY  AL+INP+YDV
Sbjct: 100 YGRAGEFRRAVADFDQAIQLNPRFYQAYANRALVQRNLGNQQAALADYNAALQINPNYDV 159

Query: 139 AYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQ 198
           AYIGRGN+YR  + + L  AF DF++AI+L T+D RA++ R L+YQ R ++ ++IEDFS+
Sbjct: 160 AYIGRGNLYR--QANQLDAAFNDFNKAIELDTADPRAYHNRGLIYQARNQHAQAIEDFSK 217

Query: 199 AISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSY 258
           AISL  S SP+ YNGRGISY+A  + D+A  DF  AINL+ K A  W N  ++YE +G  
Sbjct: 218 AISLSPS-SPEPYNGRGISYVAQGDDDNAFSDFNTAINLNGKLAESWANQALIYERRGDK 276

Query: 259 ANAVKYYKKALSVDSRYYRAKNGILR 284
           A A K Y  ALS+D +Y  A+ G+ R
Sbjct: 277 AKAAKSYSHALSLDPKYEPARAGLAR 302