RPSBLAST alignment for GI: 254780436 and conserved domain: TIGR02521

>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW. Members of this family are designated PilF in ref (PubMed:8973346) and PilW in ref (PubMed:15612916). This outer membrane protein is required both for pilus stability and for pilus function such as adherence to human cells. Members of this family contain copies of the TPR (tetratricopeptide repeat) domain. Length = 234
 Score = 63.9 bits (156), Expect = 4e-11
 Identities = 47/166 (28%), Positives = 75/166 (45%), Gaps = 14/166 (8%)

Query: 117 GDVPMAIRDYG--TALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGR 174
            DVP + R      A KI     + Y+ +G         DL+ A  + D+A++    D  
Sbjct: 16  PDVPRSSRTTDRNKAAKIRVQLALGYLEQG---------DLEVAKENLDKALEHDPDDYL 66

Query: 175 AWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFA 234
           A+   AL YQ  GE EK+ + F +A++L +  + D  N  G        Y+ A++ F+ A
Sbjct: 67  AYLALALYYQQLGELEKAEDSFRRALTL-NPNNGDVLNNYGTFLCQQGKYEQAMQQFEQA 125

Query: 235 IN--LDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRA 278
           I   L P+ A    N G+     G +  A KY  +AL +D +   +
Sbjct: 126 IEDPLYPQPARSLENAGLCALKAGDFDKAEKYLTRALQIDPQRPES 171