RPSBLAST alignment for GI: 254780436 and conserved domain: TIGR02917

>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator. Length = 899
 Score = 63.9 bits (156), Expect = 4e-11
 Identities = 58/248 (23%), Positives = 98/248 (39%), Gaps = 37/248 (14%)

Query: 55  IDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRY 114
           I +L+  +   P DP   ++ G  Y   GDFEKA      A +L+P          + + 
Sbjct: 349 IATLSPALGLDPDDPAALSLLGEAYLALGDFEKAAEYLAKATELDPENAAARTQLGISKL 408

Query: 115 KMGDVPMAIRDYGTALKINPDYDVA-------YIGRGNIYRDERYSDLQKAFADFDRAIQ 167
             GD   AI D  TA +++P+   A       Y+  G            KA A   +  +
Sbjct: 409 SQGDPSEAIADLETAAQLDPELGRADLLLILSYLRSG---------QFDKALAAAKKLEK 459

Query: 168 LKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLA-----TK 222
            +  +         +Y  +G+  K+ E F +A+    SI PD++     + LA       
Sbjct: 460 KQPDNASLHNLLGAIYLGKGDLAKAREAFEKAL----SIEPDFF--PAAANLARIDIQEG 513

Query: 223 NYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVD---------- 272
           N D A++ F+  + +DPK          +Y   G+   AV + +KA  ++          
Sbjct: 514 NPDDAIQRFEKVLTIDPKNLRAILALAGLYLRTGNEEEAVAWLEKAAELNPQEIEPALAL 573

Query: 273 SRYYRAKN 280
           ++YY  K 
Sbjct: 574 AQYYLGKG 581