RPSBLAST alignment for GI: 254780436 and conserved domain: cd00189

>gnl|CDD|29151 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here. Length = 100
 Score = 68.6 bits (167), Expect = 2e-12
 Identities = 30/102 (29%), Positives = 54/102 (52%), Gaps = 3/102 (2%)

Query: 139 AYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQ 198
           A +  GN+Y      D  +A   +++A++L   +  A+Y  A  Y   G+YE+++ED+ +
Sbjct: 2   ALLNLGNLYYKLG--DYDEALEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEK 59

Query: 199 AISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPK 240
           A+ L    +   Y   G++Y     Y+ ALE ++ A+ LDP 
Sbjct: 60  ALELDPD-NAKAYYNLGLAYYKLGKYEEALEAYEKALELDPN 100