RPSBLAST alignment for GI: 254780436 and conserved domain: COG4785

>gnl|CDD|34396 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only]. Length = 297
 Score = 48.4 bits (115), Expect = 2e-06
 Identities = 44/199 (22%), Positives = 84/199 (42%), Gaps = 16/199 (8%)

Query: 45  LFPSMG-RRVNIDSLTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYY 103
           L+ S+G R +  +  +  +   P  PE +N  G+     G+F+ A   F S L+L+P Y 
Sbjct: 74  LYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYN 133

Query: 104 KVYANRALIRYKMGDVPMAIRDYGTALKINPD--YDVAYIGRGNIYRDERYSDLQKAFAD 161
             + NR +  Y  G   +A  D     + +P+  +   +     +Y +E+  D ++A  +
Sbjct: 134 YAHLNRGIALYYGGRYKLAQDDLLAFYQDDPNDPFRSLW-----LYLNEQKLDPKQAKTN 188

Query: 162 FDRAIQLKTSDGRAWYGRALVYQMRG-----EYEKSIEDFSQAISLYSSISPDYYNGRGI 216
             +  + + SD   W G  +V    G        + ++  +   +  +    + Y   G 
Sbjct: 189 LKQ--RAEKSDKEQW-GWNIVEFYLGKISEETLMERLKADATDNTSLAEHLTETYFYLGK 245

Query: 217 SYLATKNYDSALEDFKFAI 235
            YL+  + D A   FK A+
Sbjct: 246 YYLSLGDLDEATALFKLAV 264